KEGG   Blastochloris sp. GI: BLTE_21860Help
Entry
BLTE_21860        CDS       T05837                                 

Gene name
cobT_1
Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
blag  Blastochloris sp. GI
Pathway
blag00860  Porphyrin and chlorophyll metabolism
blag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BLTE_21860 (cobT_1)
Enzymes [BR:blag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     BLTE_21860 (cobT_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT
Motif
Other DBs
NCBI-ProteinID: BBF93501
UniProt: A0A348G1R8
LinkDB All DBs
Position
complement(2329939..2330985)
Genome map
AA seq 348 aa AA seqDB search
MSERSSEAAGPTGLPFDDIRRLVAQMPGPDEKAVAAIRARDAELTKPPGSLGRLEALVEW
LAAWQGSTRPMVERPLVAIFAASHGVTARGISAFPDSVNRQMLDNFSAGGAAINQLCAAY
GLGLKVFDLAIDQPTPDISAEAALSEPACAATMAYGMEAIAGGIDLLCVGEMGIGNTTIA
AAIYHALYGGQPQDWVGPGTGLDHEGVRRKAQVIGEAVALHRAGDGDPLEVLRRLGGREV
AAIAGAILAARHQRVPVILDGFVTTAAAAVLHAMDARALDHCLAAHCSAEPAHVEVLRRL
NKTPLLDLGMRLGEGSGAAIAAGIVKGALACWRDMATFESAGVATKGT
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaacgttcgtccgaagccgccggtcccaccggccttcccttcgacgacatccgc
cgcctcgtcgcccagatgccgggcccggacgagaaggcggtggccgccatccgcgcccgc
gacgccgagctgaccaagccgccgggctcgctgggccggctggaggcgctggtcgagtgg
ctcgccgcctggcagggctcgacccggccgatggtcgagcggccgctggtggcgatcttc
gccgccagccacggcgtcaccgcccgcggcatctcggcgtttccggattcggtcaaccgc
cagatgctcgacaatttttcggccgggggcgccgccatcaaccagctttgcgccgcctac
ggcctggggctgaaggtgttcgacctcgccatcgaccagccgacgccggacatctcggcc
gaggcggcgctgagcgagccggcctgcgccgccaccatggcctatggcatggaggcgatc
gccggcggcatcgacctgttgtgcgtcggcgagatgggcatcggcaacaccaccatcgcc
gcggcgatctaccacgctctctatggcggccagccgcaggattgggtcggccccggcacc
gggctcgaccacgagggggtgcggcgcaaggcgcaggtgatcggcgaggcggtagccctg
caccgggccggcgacggcgatccgctggaggtgctgcgccgcctcggcggccgcgaggtg
gcggcgatcgccggcgccatcctggccgcccgccaccagcgcgtgccggtgatcctcgac
ggcttcgtcaccaccgcggcggcagccgtgctgcatgcgatggatgcccgcgcgctcgac
cactgcctcgccgcccactgctcggccgagcccgcccatgtcgaggtgctgcgccgcctg
aacaagacgccgctgctcgatctcggcatgcggctgggggaggggtcgggcgcggcgatc
gccgccggcatcgtcaagggcgccttagcgtgctggcgcgacatggcgacgttcgaatcg
gccggcgttgccaccaagggcacgtga

DBGET integrated database retrieval system