KEGG   Blastochloris sp. GI: BLTE_30970Help
Entry
BLTE_30970        CDS       T05837                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
blag  Blastochloris sp. GI
Pathway
blag00020  Citrate cycle (TCA cycle)
blag00190  Oxidative phosphorylation
blag00650  Butanoate metabolism
blag01100  Metabolic pathways
blag01110  Biosynthesis of secondary metabolites
blag01120  Microbial metabolism in diverse environments
blag01130  Biosynthesis of antibiotics
blag01200  Carbon metabolism
Module
blag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
blag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
blag_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:blag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLTE_30970 (sdhA)
   00650 Butanoate metabolism
    BLTE_30970 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BLTE_30970 (sdhA)
Enzymes [BR:blag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BLTE_30970 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BLTE_30970 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: BBF94412
UniProt: A0A348G4C9
LinkDB All DBs
Position
3387280..3389115
Genome map
AA seq 611 aa AA seqDB search
MSTNGSSNGAAAPAFTGAAYPVIEHAYDVVVVGAGGAGLRAVVGCSEAGLRTACVTKVFP
TRSHTVAAQGGVAASLGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMVRNAPAAVYELEH
WGVPFSRTEDGKIYQRPFGGMTTHFGKGIAQRTCAAADRTGHAMLHTMYGAALKHRAEFF
VEYFALDLIMDGGACRGVIALKLDDGTLHAFRAHKTVLATGGYGRAYFSATSAHTCTGDG
NAMVLRAGLPLQDMEFVQFHPTGIYGSGCLITEGSRGEGGYLVNSEGERFMERYAPSAKD
LASRDVVSRSMTIEIREGRGVGKNKDHIFLHLDHLDPAVLAERLPGISESAKIFAGVDVT
REPIPVIPTVHYNMGGIPTNYHGEVLTKTDGNPDHVVPGLFAIGEAACVSVHGANRLGSN
SLIDLVVFGRAAGARCAETTDRGARHAPLPKDAYEPALARLDRLRHATGATPTATLRLEM
QKVMQSNCAVFRTGEVLEEGKTLIHQVWQAADDIRVSDRSLIWNSDLVETLEFDNLIAQA
TVTMEAAANRTESRGAHAREDHPDRDDANWMKHTLLWADPVKKSVTIDYRPVHTYTLSTD
IEYIEPKKRVY
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccaacggttcttccaacggcgccgcggcgccggcgttcaccggcgcggcctat
ccggtgatcgagcacgcctatgacgtggtggtggtcggcgccggcggcgcgggcctgcgc
gcggtggtcggctgctcggaggccggcctgcgcaccgcctgcgtcaccaaggtgttcccg
acccgctcgcacaccgttgcggcgcagggcggcgtcgccgcctcgctcggcaatatgggc
gaggacgactggcgctggcacatgtacgacaccgtcaagggctccgactggctcggcgac
caggacgcgatcgagtacatggtgcggaacgccccggccgccgtctacgagctggagcac
tggggcgtgccgttctcgcgcaccgaggacggcaagatctaccagcgcccgttcggcggc
atgaccacgcatttcggcaagggcatcgcgcaacgcacctgcgccgccgccgaccgcacc
ggccacgccatgctgcacaccatgtacggcgcggcgctgaagcaccgggccgagttcttc
gtcgagtatttcgcgctcgacctgatcatggacggcggcgcctgccgcggcgtgatcgcg
ctcaagctcgacgacggcacgctgcacgccttccgcgcccacaagacggtgctggcgacc
ggcggctacggccgcgcctatttctcggccaccagcgcccacacctgcaccggcgacggc
aacgccatggtgctgcgcgccggcctgccgctgcaggacatggagttcgtgcagttccac
ccgaccggcatctacggctcgggctgcctgatcaccgagggctcgcgcggcgagggcggc
tacctcgtcaattccgagggcgagcgcttcatggagcgctacgcgccctccgccaaggat
ctggcctcgcgcgacgtggtgtcgcgctcgatgaccatcgagatccgcgagggccgcggc
gtcggcaagaacaaggaccacatcttcctgcacctcgaccatctcgatccggcggtgctg
gccgagcgcctgcccggcatctcggagagcgccaagatcttcgccggcgtcgacgtcacg
cgcgagccgatcccggtgatcccgaccgtccactacaatatgggcggcatcccgaccaat
tatcacggcgaggtgctgaccaagaccgacggcaaccccgaccatgtggtgccgggcctg
ttcgccatcggcgaggccgcctgcgtgtcggtgcacggcgccaaccggctgggctccaac
tcgctgatcgacctcgtggtgttcggccgcgccgccggggcgcgctgcgccgagaccacc
gatcgcggcgcccgccacgcgccgctgcccaaggacgcctatgagccggcgctggcccgg
ctcgaccgcctgcgccacgccaccggcgcgacgccgaccgccacgctgcgtctcgagatg
cagaaggtgatgcagtcgaactgcgcggtgttccgcaccggcgaggtgctggaagagggc
aagacgctgatccatcaggtctggcaggccgccgacgacatccgggtctccgaccgctcg
ctgatctggaactccgacctcgtcgagacgctggagttcgacaacctcatcgcccaggcg
acggtgacgatggaggctgcggcaaaccgcaccgaatcgcgcggcgcccacgcccgcgag
gatcatcccgaccgcgacgacgccaactggatgaagcacacgctgctgtgggccgacccg
gtcaagaagtcggtgaccatcgactaccggccggtgcacacctacacgctgtccaccgac
atcgaatacatcgaaccgaaaaagcgcgtctactga

DBGET integrated database retrieval system