KEGG   Blastomonas sp. RAC04: BSY18_1289Help
Entry
BSY18_1289        CDS       T04450                                 

Gene name
argJ
Definition
(GenBank) glutamate N-acetyltransferase/amino-acid acetyltransferase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
blas  Blastomonas sp. RAC04
Pathway
blas00220  Arginine biosynthesis
blas01100  Metabolic pathways
blas01110  Biosynthesis of secondary metabolites
blas01130  Biosynthesis of antibiotics
blas01210  2-Oxocarboxylic acid metabolism
blas01230  Biosynthesis of amino acids
Module
blas_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:blas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSY18_1289 (argJ)
Enzymes [BR:blas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     BSY18_1289 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     BSY18_1289 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ LppA
Motif
Other DBs
NCBI-ProteinID: AOF99204
UniProt: A0A1B3N1I4
LinkDB All DBs
Position
1307504..1308730
Genome map
AA seq 408 aa AA seqDB search
MSHSVSPLALPFPHLPAIAGVTPHVARARYKDWDRCDLSLVELAPGTTVAGVTTTSKCPS
PEVEWCRSALPQGSARALVVSAGNANAFTGGKGRNAVQMVVDTVSAQLGCAAQEVFVSAT
GVIGVPLPQDKARAGLDAAFAAAPCSWRDLTDAIGTTDTFAKAATTSAMIGDRRVELVGV
IKGSGMIAPDMATMLGYIFTDAAIAPALLQQMLSAANRSTFSCITVDSDTSTSDTVLAFA
TGQADHPRLETMDSVGADAFAAALADLCRQLAHLVVRDGEGASKFIEVRVTGAVSDESAH
RIALSIANSPLVKTAIAGEDANWGRVVMAVGKAGEPAERDLLLIRFGGVEVAAKGVVVEG
YDEAPVAAHLKGQEILVEAGIGLGQGRATVWTCDLTHGYISINADYRS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcccattccgtctcgccgctcgcgcttccctttccccaccttccggcaatcgccggc
gtcaccccgcatgtggcgcgcgcgcggtacaaagactgggaccgctgcgacctgagcctt
gtcgagctcgcccccggaacgacagtcgccggcgtcaccaccaccagcaaatgcccctcg
cccgaagtggaatggtgccgcagtgctttgccccagggcagcgcccgcgcgctggtggtg
agcgcaggcaacgccaacgcctttaccgggggcaagggccgcaatgcggtgcagatggtc
gtcgacacggtgtcggcacagctcggctgcgcggcgcaggaggtgttcgtctcggccacg
ggggtgatcggcgttccgctgccacaggacaaggcgcgcgcgggtctcgacgcggcgttc
gccgcagccccgtgcagctggcgcgatctgaccgacgccatcggcaccaccgataccttc
gccaaggccgcaaccaccagcgcaatgatcggcgaccggcgggtcgaactggtcggtgtg
atcaagggttcgggaatgatcgcgcccgacatggcaacgatgctgggctacattttcacc
gacgccgccatcgcgcccgcgctgcttcagcagatgctgagcgcggccaaccgcagcacg
ttcagctgcatcaccgtcgacagcgacacgtcgaccagcgataccgtgctcgcctttgcc
accggccaggcggatcatccccggctcgagacgatggacagcgtgggcgcggatgcgttc
gccgccgcgctggccgatctgtgccggcagctggcgcatctggtggtgcgcgatggcgaa
ggggcgagcaagttcatcgaggtgcgggtgaccggcgcagtgtccgacgagagcgcgcac
cgcattgcgctctcgatcgccaactcgcccctggtcaagaccgcgatcgcgggcgaggac
gccaattggggccgcgtcgtcatggcggtgggcaaggccggcgaacctgctgagcgcgac
ctgctcttgatccgcttcggcggggtcgaggttgcagccaagggggtcgtcgtcgaaggc
tatgacgaagccccggttgcggcgcacctcaaggggcaagagattctggtcgaggccggt
atcgggctgggacagggccgcgcaacggtgtggacctgcgacctcacccacggctatatc
tcgatcaacgccgactaccggagctaa

DBGET integrated database retrieval system