KEGG   Blastomonas sp. RAC04: BSY18_1356Help
Entry
BSY18_1356        CDS       T04450                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
blas  Blastomonas sp. RAC04
Pathway
blas00040  Pentose and glucuronate interconversions
blas00053  Ascorbate and aldarate metabolism
blas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSY18_1356
   00053 Ascorbate and aldarate metabolism
    BSY18_1356
Enzymes [BR:blas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BSY18_1356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOG01935
UniProt: A0A1B3N997
LinkDB All DBs
Position
complement(1397727..1399307)
Genome map
AA seq 526 aa AA seqDB search
MINGAMLIGDTERQAASRFQSHDPATGAALEPGFSSATAEDVAEACALAAAAAPGYAASD
PESRAVFLEAIASAIEAVGDDLILRAMQESGLPRARLEGERGRTTGQLRLFASVVRQGDW
LDATIDPAMPDRAPLPRPDLRRMNLPVGPVAVFGASNFPLAFSVAGGDTASALAAGCPVV
VKGHPAHPGTGELVARAIQSAVTQCGMPAGTFSYLPGETNALGAALVGDPRIKAVGFTGS
RGGGLALVRIAAERAEPIPVYAEMSSINPVILMPAALAARGTALAEGFVQSLTMGAGQFC
TNPGLVIAVGGEALDGFVAAAGEALSRSAPATMLSPGIHASFEQGVALLAQHDSVETVAR
GLPCTGENQAVGALFQTSAAQFLADAALGHEVFGSSSVIVRCADLAEVVRVVASLEGQLT
ATLQLDQADIADARRLLPVLADRVGRVLANGWPTGVEVAHAMVHGGPFPATSDGRTTSVG
TLAIHRFLRPVAFQNLPPELLPNAIGETNPWGLARRIDGIREGSPR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacggtgccatgctgatcggcgacaccgagcgccaggcggcctcgcgcttccag
agccacgaccccgccaccggtgctgcgctcgaacccggattttccagcgccacggcagag
gatgtcgccgaagcgtgcgcattggcagccgccgctgcacctggctatgccgcaagcgat
cccgagagccgtgcggtgtttctcgaggcgatcgcgagcgcgatcgaggcagtgggcgat
gatctgatcttgcgcgcaatgcaagaaagcggcctgccgcgcgcgcggctcgaaggcgag
cgcggacgcaccacagggcaactgcggcttttcgccagcgtcgtgcggcagggggactgg
cttgatgcgacgatcgacccggcgatgcccgaccgggctccgctgccacggcccgatctg
cgccggatgaaccttcccgtcggcccggtcgcggtgttcggcgcgtccaacttcccgctc
gccttttcagtggcgggcggtgacaccgcgtccgcgctcgctgcaggctgcccggtggtg
gtcaagggccaccccgcgcaccccggcaccggcgagctcgtcgcgcgcgcgatccagagc
gcggtgacgcaatgcgggatgcctgcgggcaccttttcctatctgccgggtgagaccaat
gcactgggcgccgccctggtcggcgacccgcgcatcaaggctgtgggcttcacgggatcg
cgcggaggcgggctggcgctggtgcgcatcgccgccgagcgtgccgaaccgatccccgtc
tatgccgagatgtcgagcatcaacccggtgatcctgatgcccgccgcgctcgctgcacgc
ggcaccgcacttgccgaggggttcgtccagtcgctgaccatgggggcagggcagttctgc
accaaccccggcctggtaatcgcggtcggcggcgaggcactcgacggcttcgtcgccgcg
gcaggcgaggcgctgtcgcgcagcgcgcctgccaccatgctcagtcccggcatccacgcc
agcttcgaacagggcgtggctctgcttgcgcagcatgattcggtcgaaaccgtggcgcgc
ggtctgccctgcaccggcgagaaccaggccgtcggcgcgcttttccagaccagcgcggcg
cagttcctcgccgatgcggcgctggggcatgaagttttcggatcgtcctcggtgatcgtc
cgctgcgccgatttggcagaagtcgtccgggtcgtagccagcctggaaggtcagttgacc
gcaacgctgcagctcgaccaggccgacattgccgatgcgcggcgcctgttgcctgtgctg
gcggaccgggtcggccgtgtgcttgccaatggctggccgaccggcgtcgaggtggcccat
gccatggtgcatggcgggccgttccccgcgaccagcgacggccgcacgacatcggtgggc
acgcttgcgatccaccgcttcctgcggcccgtggcgttccagaacctgccgcccgagctt
cttccgaatgcgatcggcgagaccaatccctggggtctcgcccgccgcatcgatggcatc
cgcgagggatcgccgcgctag

DBGET integrated database retrieval system