KEGG   Blastomonas sp. RAC04: BSY18_1811Help
Entry
BSY18_1811        CDS       T04450                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
blas  Blastomonas sp. RAC04
Pathway
blas00620  Pyruvate metabolism
blas00680  Methane metabolism
blas01100  Metabolic pathways
blas01120  Microbial metabolism in diverse environments
blas01200  Carbon metabolism
Module
blas_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:blas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY18_1811
  09102 Energy metabolism
   00680 Methane metabolism
    BSY18_1811
Enzymes [BR:blas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BSY18_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOF99518
UniProt: A0A1B3N2E5
LinkDB All DBs
Position
1906065..1908767
Genome map
AA seq 900 aa AA seqDB search
MADIDTTPPAPISQNPDIRYLGRILGDVIRAYGGEKLFRQTEYIRSASVDRHRGVAGADG
IDTGLDSLNLDDTLAFVRGFMLFSMLANLAEDRQGMAQETGATLAEAVERLREHGIGDAA
ITDLLEHSLIVPVLTAHPTEVRRKSMIDHKNRVADLMKMKDAGLYHTPSGDRIDEALHRQ
IALLWQTRPLRRDRLFVADEVENARAYMQDVFLPALPMLYARWERVLGHRPPAFLRLGSW
IGGDRDGNPFVTADALRHALGRQCETALVHYLDGVHALGQDLSIATGLSNTPDAVLALAE
ASGDTSPSRADEPYRRALAGIYARLCATHIRLTGKQPPRPSMLSGEAYASPAELRHDLAV
LANGLASDGAGILASGGALGRLIRAVEIFGFHLATLDLRQNSDVHERVVAELLKVAGVCA
DYAALDEAARVALLRAELGHGRLLINRWHDYSEETAKEIAIVEAAAQAHVDYGPQAITAY
NISKAESVSDMLEVNLLLKEAGLYRPGGDAGAAPQAAIMAVPLFETISDLEAAPQVMRAY
FALPEIAGLVKARGYQEVMVGYSDSNKDGGYLTSTWSLNHASRALAKVFADTGIAMQLFH
GRGGAVGRGGGSSFAAIRAQPKGTVQGRIRITEQGEVIAAKYGTVESAELNLEAITSAAL
IATLDHDDLSEADEARFAAAMDMISRDAFRSYRELVYGTEGFNQFFRAATPITEIAGLKI
GSRPASRSKSQRIEDLRAIPWVFSWAQARIMLPGWYGVGQALQGHTDKGLLTAMAQGWPF
FQALLGNMEMVLAKSDMGIARHYAGLVPDEKLREQVFGAITSGWNAAHDNLLSITGQSRL
LADNPALDASIRLRLPYIEPLNLLQIELIKRHRAGEADERIPEGIQLSINAIATALRNSG
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcagacatagataccaccccgcccgcccccatcagccagaaccccgatatccgctat
cttggccggatcctgggcgacgtcatccgcgcctatggcggcgagaagctgttccgccag
accgagtacatccgctcggccagcgtcgaccggcaccgcggcgttgccggcgccgatggc
atcgacaccggtctcgattcgctcaatctcgacgacacgctcgcctttgtgcgcggattc
atgctgttttctatgctcgccaatctcgccgaggaccggcagggcatggcgcaggagacc
ggtgcaaccttggcagaagcggtcgagcggctgcgcgaacatggcatcggcgatgccgcg
atcaccgacctgctcgagcacagcctgatcgttccggtgctcaccgcgcaccccaccgaa
gtgcggcgcaagtcgatgatcgaccacaagaaccgcgttgccgatctgatgaagatgaag
gatgcggggctctaccacacccccagcggcgaccggatcgacgaggcgctgcaccgccag
atcgctctgctgtggcagacccgtccgctgcgccgcgaccggctgttcgtcgccgacgaa
gtggagaatgcccgcgcctacatgcaggacgtgttcctccccgcgctgccgatgctctat
gcccgctgggagcgcgtgctgggccaccgcccgcccgcgttcctgcggctgggcagctgg
atcggcggcgaccgcgacggcaacccgttcgtcaccgccgatgcgctgcgccatgcgctg
gggcggcagtgcgagaccgcgctggtgcattatctcgacggcgtccacgcgctcggccag
gacctttcgatcgccaccgggctttcgaacacccccgatgcggtgctggcgctggcggaa
gccagcggcgacacctcgcccagccgcgccgacgaaccttatcgccgcgcgcttgcagga
atctatgcgcggctgtgcgccacgcatatccgcctcaccggcaagcagccgccgcgcccc
tcgatgctctcgggcgaggcctatgccagccccgccgagctgcggcacgatctggcggtg
ctcgccaacgggcttgccagcgatggcgcgggaatcctggcgagtggcggcgcgctggga
cggctgatccgcgcggttgaaatcttcggcttccacctcgccacgctcgacctcaggcag
aacagcgacgtccacgagcgcgtggtggcagagctgctcaaggtcgcaggcgtgtgcgcc
gattacgccgcgctggacgaggcggcccgcgtcgcgttgctgcgcgccgagctcggccat
ggccgcctgctgatcaaccgctggcacgattacagcgaggagaccgccaaggagatcgcg
atcgtcgaggccgccgcccaggcgcatgtcgattacgggccgcaggcgatcaccgcgtac
aacatcagcaaggccgaaagcgtgtccgatatgctcgaggtcaacctgctgctcaaggaa
gccgggctctaccgccccggcggcgatgccggggccgccccgcaggctgctatcatggcg
gtgcccttgttcgagacgatcagcgatctcgaagccgcaccgcaggtgatgcgcgcttat
ttcgcgcttcccgaaatcgcaggcctggtgaaggcgcgcggctatcaggaggtgatggtc
ggctattcggatagcaacaaggacggcggctatctcacctcgacctggagcctcaaccac
gccagtcgcgcactcgccaaggtgttcgccgataccgggatcgcgatgcaattgttccac
ggccgcggcggtgcggtcgggcgcggtggcggatcgagctttgccgcgatccgcgcgcag
cccaagggcacggtgcagggccgcatccgcatcaccgaacagggcgaggtcatcgccgcg
aaatacggcacggtcgaaagcgccgagctcaacctcgaggcgataacctcggccgccctg
atcgcgacgctcgaccatgatgatctgagcgaagccgatgaggcgcgctttgccgccgcg
atggacatgatctcgcgcgatgccttccgcagctatcgcgagctcgtctacggcaccgag
gggttcaaccagttcttccgcgccgccaccccgatcaccgagatcgccgggctcaagatc
ggctcgcgtccggcaagccgctccaagagccagcggatcgaggatctgcgcgctataccc
tgggtgttcagctgggcgcaggcgcggatcatgctgccgggatggtatggggtcggccag
gcgctgcaggggcataccgacaagggcctgctcaccgcgatggcgcagggctggccgttt
ttccaggcgctactcggcaatatggagatggtgctggccaagtccgacatggggattgcg
cgccattatgccgggctggtccccgacgaaaagctgcgcgagcaggtcttcggcgcgatc
acatcgggctggaacgcagcgcacgacaatctgctgagcatcaccggtcagtcgcgactg
ctcgcggacaatcccgcgctagatgcctcgatccggctgcggctgccctatatcgagccg
ctcaacctgctgcagatagagctgatcaagcgccaccgcgcgggcgaggccgacgagcgt
attcccgagggcatccagctgtcgatcaacgcaattgccaccgcgctgcgcaacagcggc
tga

DBGET integrated database retrieval system