KEGG   Blastomonas sp. RAC04: BSY18_1975Help
Entry
BSY18_1975        CDS       T04450                                 

Definition
(GenBank) cobW/HypB/UreG, nucleotide-binding domain protein
Organism
blas  Blastomonas sp. RAC04
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cobW CobW_C MeaB T2SSE RsgA_GTPase AAA_16 TsaE MobB Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AOG00659
UniProt: A0A1B3N5N5
LinkDB All DBs
Position
complement(2092243..2093484)
Genome map
AA seq 413 aa AA seqDB search
MPTPIPAPDRKLPVTVLSGFLGAGKTTLLNHILANVEGLRVAVIVNDMSEVNLDAALVRG
GEAALSRASEELVEMTNGCICCTLRDDLLKEVRSLAEVGRFDYLVIESTGISEPLPVAAT
FSFRDESGESLGDVATLDTMVTVVDAVNLLNDYASHEFLADRGESLGEDDTRSLVALLVE
QIEFADVIIVNKAEDVPAEHLATVTKLCASLNADARIIPASRSKVDLAQILGTGLFDDDR
AAEHPLWAKELYGYATHRPETEEYGIESFVYRARRPFAPDRFYAFLTGDGLEGVVRAKGF
FWLATRTEWVGELAVAGSQTMTSRLGRWWASVPKNQWPHDNQFEDFVAHNWDAVWGDRRQ
ELVFIGINMDEARLRAGLDACLVDAEGYTPDAWQRLADPFPAWGEQARVLESA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgccgatacccgccccggaccgcaagttgcccgtcaccgtgctttctggcttc
ctcggcgcgggcaagaccacgctgctcaaccacatcctggccaatgtcgagggcctgcgc
gtcgcggtgatcgtcaacgacatgtcggaagtgaacctcgacgccgctctggtgcgcggc
ggcgaggcggcgctcagccgggcgagcgaggagctggtcgagatgaccaatggctgcatc
tgctgcacgctgcgcgacgatctgctcaaggaggtgcgcagcctcgccgaggtgggcagg
ttcgactatctggtgatcgaaagcaccggcatctccgagccgctgccggtcgcggcaacc
ttcagcttccgcgacgagtcaggcgagagcctcggcgatgtcgccacgctcgacaccatg
gtgaccgtggtcgatgcggtgaacctgctcaacgattatgccagccacgaattcctggcc
gatcgcggcgaatccctcggcgaggacgatacgcgcagcctggtcgcgctgctggttgag
cagatcgagtttgccgatgtcatcatcgtcaacaaggccgaggacgttcccgcagagcat
ctggcgaccgtcaccaaattgtgcgcctcgctcaacgccgatgcgcggatcatccccgcc
agccgctcgaaggtcgatcttgcgcagatcctcggcaccggactgttcgacgacgaccgt
gcggcagagcatcccttatgggccaaggagctgtacggctatgccacccatcggcccgag
accgaggaatacggcatcgagagcttcgtctatcgtgcgcgccgtccgttcgcgcccgat
cgcttttatgcctttctgaccggagacgggctggaaggtgttgtccgcgccaagggtttc
ttctggctggcgacgcgcaccgaatgggtcggcgaactcgcggtggcgggatcgcagacg
atgacgtcgcggctgggccgctggtgggcatcggtgcccaagaaccagtggccgcacgac
aaccagttcgaggatttcgtcgcgcacaactgggatgcggtctggggcgaccggcggcag
gaactggtgttcatcggcatcaatatggacgaggcgcggcttcgcgccggactcgatgcc
tgtctggtcgacgccgagggctatacccccgatgcctggcagcgcctcgccgatccgttt
ccggcctggggcgaacaggcccgtgtcctggagagcgcctga

DBGET integrated database retrieval system