KEGG   Blastomonas sp. RAC04: BSY18_2144Help
Entry
BSY18_2144        CDS       T04450                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
blas  Blastomonas sp. RAC04
Pathway
blas00473  D-Alanine metabolism
blas00550  Peptidoglycan biosynthesis
blas01100  Metabolic pathways
blas01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:blas00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSY18_2144
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSY18_2144
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BSY18_2144
Enzymes [BR:blas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BSY18_2144
Peptidoglycan biosynthesis and degradation proteins [BR:blas01011]
 Precursor biosynthesis
  Amino acid ligase
   BSY18_2144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AOF99216
UniProt: A0A1B3N1K3
LinkDB All DBs
Position
complement(2269990..2270940)
Genome map
AA seq 316 aa AA seqDB search
MTLPKLHIAVLMGGWSAEREVSLMSGEGVAKALESRGHTVTRVDMDRNVAAVLAGIRPDL
VFNALHGTPGEDGSVQGMLDLMQIPYTHSGMATSVIAIDKVLTKQALLPHGIPMPGGHIV
RSESLYTGDPLPRPYVLKPVNEGSSVGVAIVKADSNYGDPIARDAVGPWQEFDELLAEPF
IKGRELTTAVLGDRALGVTELQTKSGFYDYDAKYTDGLTLHICPADIPEDIAALCMDLAL
RAHNILGCKGASRSDFRWDDEKGVDGLFLLEVNTQPGMTSLSLVPEQAAHIGISYADLVE
IIVESALGGTRHDDTD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgactctccccaagctccatatcgccgtgctgatgggcggctggtcggccgaacgcgag
gtgtcgctgatgagcggcgagggcgtcgccaaggcgctggaatcgcgcgggcataccgtg
acccgcgtcgacatggatcgcaatgtcgccgcggtgctcgccggcatccgccccgatctg
gtgttcaacgcgctgcacggtacaccgggcgaggatggcagcgtgcagggcatgctcgat
ctgatgcagatcccgtacacgcactctggcatggccacctcggtgatcgcgatcgacaag
gtgctgaccaagcaggcgctgctgccgcacggcattccgatgcccggcgggcacatcgta
cgctctgaaagcctctacaccggcgacccgctgccgcggccttatgtgctcaagcccgtc
aacgaaggctcgtcggtcggtgtcgccatcgtcaaggcggacagcaattatggtgacccg
attgcgcgcgatgccgtgggaccatggcaggaattcgacgagctgctcgccgaacctttc
atcaagggccgcgagctgaccactgccgtgctgggcgaccgggcattgggcgtcaccgag
ctgcagaccaagtcgggcttctacgactatgatgccaagtataccgacggcctgacgctg
cacatctgccctgccgacatccccgaggatatcgcggcgctgtgcatggacctggcactg
cgcgcgcacaacatcctgggatgcaagggcgcatcgcgctcggacttccgctgggatgac
gagaagggtgtggacgggctgttcctgctcgaagtcaacacacagccgggtatgacatct
ctcagcctggttcccgaacaggcggcacatatcggcatcagctatgccgatctggttgag
attatcgtggaaagcgcattggggggcacccggcatgacgacacggattaa

DBGET integrated database retrieval system