KEGG   Blastomonas sp. RAC04: BSY18_285Help
Entry
BSY18_285         CDS       T04450                                 

Definition
(GenBank) angiotensin-converting enzyme family protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
blas  Blastomonas sp. RAC04
Brite
KEGG Orthology (KO) [BR:blas00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:blas01002]
    BSY18_285
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:blas04147]
    BSY18_285
   04090 CD Molecules [BR:blas04090]
    BSY18_285
Enzymes [BR:blas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BSY18_285
Peptidases [BR:blas01002]
 Metallo Peptidases
  Family M2
   BSY18_285
Exosome [BR:blas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY18_285
CD molecules [BR:blas04090]
 Proteins
  BSY18_285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AOF98872
UniProt: A0A1B3N0N1
LinkDB All DBs
Position
282389..284230
Genome map
AA seq 613 aa AA seqDB search
MKSLKSIVSVIALSVAACAVPAFAEDAAPQSAAARPTAADADAFVTAAEKEMYDYIISAS
RVFWVNSTYLTDDTNALAAEVGAKGTEMQVRFALEAAKFNDVAGLSDETRRKLDKMRGGI
VLPAPTTPGAAAELNTIATNLQSIYGKGKGTLDGKPVNGSDIEAAMGESRDPDALKEMWA
SWHDNVGAPMKDDYARMVDIANQGARELGFKNVGAMWRSQYDMSADEFAALTEKLWQQVK
PLYDDLHCYTRTKLNEKYGDAVQAKTGPIRADLLGNMWAQEWGNIYDVVAPAGAGDIGYD
VTELLKAKQYDPIKMVKGGEAFFSSLGFAPLPETFWQRSQFTKPADREVICHASAWDVDN
KDDIRIKMCIKVNADDFTTIHHELGHNYYQRAYNKQDTLHLDGANDGFHEAIGDMVALSI
TPDYLVEIGLLDKAKVPGADKDLGLLLRQGMDKLAFLPFGLLVDRWRWGVFDGSIKPAGY
NEAWTALRLQYQGITPPVDRPDNAFDAGAKYHIPGNTPYTRYFLARILQFQFYKAACDIA
GWKGPLHRCTFYGNKEVGNRLNAMLEMGASKPWPDALEAFTGSREMDGTAMVEYFAPLQT
WLKEQNKGKQCGW
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccctgaaatcgatcgtgtccgtcatcgcattgtcggttgccgcctgcgctgtt
cccgcatttgccgaggatgctgctccgcagagcgccgctgccaggccgaccgctgccgat
gccgatgcctttgttaccgctgccgaaaaggagatgtacgactacatcatctcggcgagc
agagtgttctgggtcaactcgacctatctgaccgacgataccaatgcgctggcggccgag
gtcggcgccaaggggaccgagatgcaggtgcgcttcgcgctcgaggcggcgaagttcaac
gatgtcgcaggactcagcgacgagacgcggcgcaagctcgacaagatgcgcggcggcatc
gtgctgcccgcgccgaccactccgggcgcagcggccgagctcaacaccatcgccaccaac
ctgcagtcgatctacggcaagggcaagggtacgcttgatggcaagccggtgaacggatcg
gacatcgaggcagccatgggcgaaagccgtgaccccgatgcgctcaaggaaatgtgggcg
agctggcacgacaatgtcggcgcgccgatgaaggacgactacgcccggatggtcgacatc
gccaaccagggcgcgcgcgagctgggcttcaagaatgtcggcgcgatgtggcgctcgcaa
tacgatatgagcgcggacgagttcgccgcgctgaccgagaagctctggcagcaggtcaag
ccgctgtacgacgatctgcactgctacacccgtaccaagctcaacgagaaatatggtgat
gcggtgcaggccaagaccggcccgatccgcgccgatctgctcggcaacatgtgggcgcag
gaatggggcaacatctatgatgtggtggcgcctgcgggcgcgggcgacatcggctatgat
gtcaccgagctgctcaaggccaagcagtatgatccgatcaagatggtcaagggcggggag
gcgttcttctcctcgctgggctttgcgccgttgcccgaaaccttctggcagcgctcgcag
ttcaccaagcccgccgaccgcgaggtgatctgccatgcgtctgcctgggatgtcgacaac
aaggacgatatccgcatcaagatgtgcatcaaggtgaatgccgacgacttcaccaccatc
caccatgagttggggcacaattactatcagcgggcctataacaagcaggacacgctgcat
ctcgatggcgccaatgatggcttccacgaggcgatcggcgacatggtcgcgctgtcgatc
acgcccgattatctggtcgagatcggcctgctcgacaaggccaaggtacccggcgcggac
aaggaccttgggctgcttctgcggcagggcatggacaagctggcgttcctgcccttcggc
ctgctggtcgaccggtggcgctggggcgtgttcgacggcagtatcaagcctgccggatac
aacgaggcctggacggcgctgcgcctgcagtaccaggggatcacgccgccggttgatcgg
cccgacaatgcgttcgacgctggcgcgaaataccatatccccggcaacacgccctatacc
cgctatttcctcgcgcgaatcctgcagttccagttctacaaggccgcgtgcgacatcgcc
ggctggaagggcccgctccatcggtgcaccttctacggcaacaaggaggtcggcaaccgg
ctgaacgcgatgctggagatgggtgcgtccaagccctggcccgatgcgctcgaggcgttc
accggatcgcgcgaaatggatggcaccgcgatggtcgaatatttcgcgccgctccagacg
tggctcaaggaacagaacaagggcaagcaatgcggctggtaa

DBGET integrated database retrieval system