KEGG   Blastomonas sp. RAC04: BSY18_3402Help
Entry
BSY18_3402        CDS       T04450                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
blas  Blastomonas sp. RAC04
Pathway
blas00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:blas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSY18_3402
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:blas02000]
    BSY18_3402
Enzymes [BR:blas01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BSY18_3402
Transporters [BR:blas02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSY18_3402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N_2 GST_C GST_N
Motif
Other DBs
NCBI-ProteinID: AOG01327
UniProt: A0A1B3N7K6
LinkDB All DBs
Position
3612949..3613608
Genome map
AA seq 219 aa AA seqDB search
MTIELFAHPFSSYCQKVLVALYENATPFTLRMLGPDHPDNGAALAALWPLGKFPLLREGD
RVVMEASTIIEYLGIAHPGTTPLIPADPAAALQVRMMDRIFDNYVMTPQQKVVSDAMRAA
DARDPAGLADARAMLDEIYRWLDARMQDRVWAAGDAFTLADCGAAPALFYADWSHPIPAG
LQALHAYRARLLARPSFARAVDEARPYRPLFPPGAPERD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgagctttttgcgcacccgttctcgtcctattgccagaaggtgctggtggcc
ctttacgagaacgcgacgccattcaccttgcggatgctcggcccggaccatcccgacaat
ggtgctgcgctggctgcgctctggccgctgggcaagttcccgttgctgcgcgagggcgat
cgcgtcgtgatggaagcgagcacgatcatcgaatatctcggcatcgcccaccccggcacc
accccgctgatccccgccgatccggctgcggcgctgcaggtgcggatgatggaccgcatc
ttcgacaattatgtcatgaccccgcagcagaaggttgtctccgatgcgatgcgcgctgcc
gatgcccgcgatcctgccgggctggccgatgccagggcgatgctcgatgaaatatatcgc
tggctcgacgccagaatgcaggaccgggtctgggctgccggtgatgcctttacccttgcc
gattgcggcgcggcgccggccctgttctatgctgactggtcgcacccgatccccgccggg
ctgcaggcgctgcatgcctatcgggcgcggctgctggcgcggccctcgtttgcccgcgcg
gtggacgaagcgcggccgtatcgaccgctgtttccgcccggtgcgcccgagcgcgactga

DBGET integrated database retrieval system