KEGG   Blastomonas sp. RAC04: BSY18_3429Help
Entry
BSY18_3429        CDS       T04450                                 

Gene name
qgdA
Definition
(GenBank) quinohemoprotein alcohol dehydrogenase ADH-IIG
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
blas  Blastomonas sp. RAC04
Brite
KEGG Orthology (KO) [BR:blas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSY18_3429 (qgdA)
Enzymes [BR:blas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     BSY18_3429 (qgdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: AOG00729
UniProt: A0A1B3N5U6
LinkDB All DBs
Position
3637053..3638900
Genome map
AA seq 615 aa AA seqDB search
MVIDGVMYTSTAWSKVYAIDARTGKQLWQFDPQVPGDAAYSTCCDVVNRGVAVWRGKVFV
GTIDGRLIAIDARTGDQLWSVQTFDRSHPYAITGAPRVFKDKVIIGNGGAEFGVRGYVTA
YDTETGAQLWRFYTVPGDPSKEPDGAASDSVMPMATRTWAGKWYTMGGGGTAWDSIVYDP
EFDQVYIGVGNGAPWNRQVRSDGKGDNLFLSSIVAVDADTGKYKWHYQQIPGESWDFTAT
QPMMLATLSIGGKPRRVLMQAPKNGFFYVLDRKTGKLLSAKAFVPQTWADHIDLATGRPV
MSENAYYQNGAKVMSPASVGGHNWQPMSYSPRTGLVYIPTVRWSMRYDQDPAFKFRPGAE
LNQGAAISLDPAAPWGTGALIAWDPLRQREVWRVPQPEMINGGTIATAGDLVFAGDAHGT
FSAFGARDGKRLWSFKQPSGILAAPASYSIDGVQYIAVLVGKGGGAMGLPDVNRPRIPRL
NGRMLVFKLGGKAVLPRVDLDLPPANPPGQTFSPATVALGGRLYGDKCARCHEGVAAPDL
RRSNALSDAETWKAVVYDGVLTDTGMIGFSKLMSQAQVEAIRAYVGDLALELQKEAKTAP
GKGATAKDMARAKPQ
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
ttggtcattgacggcgtcatgtacacgtcaacggcttggtcgaaggtctatgctatcgat
gcacgtacgggcaagcagctgtggcagttcgatccgcaggttcccggtgatgcagcctac
agcacctgctgcgatgtggtgaatcgcggcgtggctgtctggagggggaaggtttttgtc
ggtacgatcgatgggcggctgatcgcgatcgatgcgaggaccggcgatcagctttggtcc
gtacagaccttcgaccgctcccatccctacgcgattaccggcgcccccagggtattcaag
gacaaggtcatcattggcaatggcggtgccgaattcggcgtccgcgggtatgtcactgct
tatgataccgaaaccggtgcgcagttatggcgtttctacactgtgccaggcgatccgtcg
aaagagcccgacggtgctgcatcagattcggtgatgccaatggcgaccagaacctgggcg
ggcaagtggtacacgatggggggaggcggcaccgcctgggactcgatcgtttatgatccc
gaattcgaccaggtctatatcggcgtgggcaacggtgcaccgtggaaccggcaggtccgc
tcggacggcaagggtgataacctgttcctgtcctcgatcgtcgcggtcgatgccgacacg
ggcaagtacaaatggcattatcagcagatacctggtgaaagctgggacttcaccgcgacc
cagccgatgatgctggccacgctttcgatcggcggaaaaccgcgcagggtgctgatgcag
gcgccgaaaaacggcttcttctatgttctcgatcgaaagaccggcaagctgctctctgcc
aaggcattcgtcccgcagacctgggccgaccatatcgatttggcaactgggcgtccggtc
atgagcgagaatgcctattaccagaatggcgcgaaagtcatgtccccggcttcggtcggc
ggccacaactggcagcccatgtcctacagcccccgcaccgggctggtgtacattcccacc
gtccgctggagcatgcgatatgaccaggaccctgcgttcaagttccgtcccggcgctgaa
ctgaaccaaggggcagcgatcagcctcgatcctgctgcaccttggggcaccggcgcattg
attgcctgggatccgctcagacagcgcgaagtctggcgggtaccacaacccgagatgatc
aacggcggcacgatcgcgacggcaggcgatctggtgtttgccggcgatgcgcatggcacg
ttcagcgcatttggagcaagggacggtaaaaggctgtggtcgttcaagcagccatcgggc
atcctcgcagcgccagccagctacagcatcgatggcgttcaatatattgcggtgttggtc
ggaaagggcggtggtgccatgggcctgccggatgtcaatcgtccccggattccgaggctt
aacggccggatgctggtgttcaagctgggcggaaaggccgtgctgccccgggtcgatctc
gatcttccgccagccaatccgcccgggcagacattctccccggccactgtcgccttgggc
gggcggctgtatggcgataagtgcgcgcggtgccatgagggggtcgcggcgcctgatctg
cgtcgctccaacgcgctgtccgatgcggaaacgtggaaggccgtcgtttacgatggcgtg
ctgaccgacaccggtatgatcggcttttcaaagctgatgtcgcaggcgcaggtcgaagca
atccgggcttatgtcggcgatctggcgctcgaacttcagaaggaagcgaagacagcaccc
ggcaagggggcaactgccaaggatatggcacgcgcaaaaccgcaatag

DBGET integrated database retrieval system