KEGG   Blastomonas sp. RAC04: BSY18_990Help
Entry
BSY18_990         CDS       T04450                                 

Definition
(GenBank) DNA ligase, ATP-dependent, family
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
blas  Blastomonas sp. RAC04
Pathway
blas03030  DNA replication
blas03410  Base excision repair
blas03420  Nucleotide excision repair
blas03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:blas00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BSY18_990
   03410 Base excision repair
    BSY18_990
   03420 Nucleotide excision repair
    BSY18_990
   03430 Mismatch repair
    BSY18_990
Enzymes [BR:blas01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BSY18_990
    6.5.1.6  DNA ligase (ATP or NAD+)
     BSY18_990
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BSY18_990
DNA replication proteins [BR:blas03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BSY18_990
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BSY18_990
DNA repair and recombination proteins [BR:blas03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BSY18_990
   NER (nucleotide excision repair)
    Other NER factors
     BSY18_990
   MMR (mismatch exicision repair)
    Other MMR factors
     BSY18_990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: AOG00758
UniProt: A0A1B3N5X7
LinkDB All DBs
Position
complement(989490..991055)
Genome map
AA seq 521 aa AA seqDB search
MRAFAALVTQLGYTRSRNAKVALIADYLRAAPDPDRGWALAALTGEADFAAVKSSSVRTM
AMERVDPELFRLSRDFVGDTAETVALIWPETAPPANELRLADAVDSFANVSRARAPALLA
EYMDRLDSDGRYALIKLATGAMRVGISARLAKTAFAQAFGLDVDAVEEVWHALSPPYASL
FAWGEGGARPDPEGTPYFRPFMLAHPLEDGTVDLADYAAEWKWDGIRIQIVRVGDDVRLF
SRGGDDITAAFPDIAAHMPVEGVFDGELLVRGDAQMGEAASFNALQQRLGRKTVSAKMLA
EAPAFVRLYDLLIDGCEDLRLQPWHLRRARLEQRMGALPADRFDLSQIIMAQDFDELGRI
RDGARDAAIEGVMLKRRDSLYVPGRRVGLWYKWKRDPLSADCVMMYAQRGSGKRSSFYSD
YTFGCWTEDGELVPVGKAYSGFSDTELKWLDKFVRQNTVNRFGPVREVEKSLVLEVAFDS
IHESKRHKSGIAMRFPRISRLRRDKPAAEADTVTTLRALIT
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgttcgctgcgctcgtcacccagctgggctatacccgctcgcgcaacgccaag
gtcgcgctgatagcggactatctgcgcgctgcacccgatcccgatcgcggctgggcgctg
gccgcgctgaccggcgaggcggattttgcagcagtgaaatcctcgtccgtccgtaccatg
gcgatggaacgggtcgaccccgagctgttccgcctgagccgcgatttcgtcggcgatacc
gccgaaacggtcgcgctgatctggcccgagacggcacctcccgccaacgaactgaggctt
gccgatgcggtggacagctttgccaatgtcagccgggcccgcgcgccagcgctgctcgcc
gaatatatggacaggctggacagcgatggccgctatgcgctgatcaagctcgcgacaggc
gcaatgcgcgtcggcatctccgcccggctcgccaagaccgcttttgcccaagccttcggg
ctagatgtcgatgcggtcgaagaggtgtggcacgcgctgtcgccgccctatgccagcctt
ttcgcctggggtgaaggcggcgcgcggcccgatcccgagggcaccccctatttccgcccg
ttcatgctcgcgcacccgctcgaggacggcacggtcgaccttgccgattatgctgccgag
tggaaatgggatggcatccgcatccagatcgtccgtgtcggtgatgacgtgaggctgttc
agccggggcggcgacgacattaccgcagcgttccccgacatcgccgcgcacatgccggtc
gagggtgtgttcgatggcgaactgctggtgcggggcgatgcgcagatgggcgaggctgca
agcttcaacgcgctgcagcaacggctggggcgcaagacggtctcggccaagatgctcgcc
gaggcgcccgcgttcgtgcggctgtatgatctgctgatcgacggctgcgaagacctgcgg
ctgcaaccctggcacctgcggcgcgcgcggctcgagcagcgcatgggcgcgcttcccgcc
gaccggttcgacctgtcgcagatcatcatggcgcaggatttcgacgagctcggccgcatc
cgcgatggcgcgcgagatgccgcgatcgagggggtgatgctcaagcgccgcgacagcctg
tatgtccccgggcgccgcgttggactgtggtacaaatggaagcgcgatccgctgagcgcc
gattgcgtgatgatgtatgcgcaacgcggcagcggcaagcgctcgtccttctattcggac
tataccttcggctgctggaccgaggacggcgagctggtcccggtgggcaaggcctattcg
ggtttctccgacaccgagctcaaatggctcgacaagttcgtccgccagaataccgtcaat
cgcttcggcccggtgcgcgaggtcgaaaagtcgctggtgctcgaagtggccttcgattcg
atccacgaatccaagcgccacaaatcgggtatcgcgatgcgctttccgcgtatctcgagg
ctgcggcgtgacaagcccgctgccgaggcggatacggtgacgacgctgcgagcgctgata
acctag

DBGET integrated database retrieval system