KEGG   Burkholderia latens: WK25_07445Help
Entry
WK25_07445        CDS       T04819                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
blat  Burkholderia latens
Pathway
blat00020  Citrate cycle (TCA cycle)
blat00310  Lysine degradation
blat00380  Tryptophan metabolism
blat01100  Metabolic pathways
blat01110  Biosynthesis of secondary metabolites
blat01120  Microbial metabolism in diverse environments
blat01130  Biosynthesis of antibiotics
blat01200  Carbon metabolism
Module
blat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
blat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:blat00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WK25_07445 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    WK25_07445 (sucA)
   00380 Tryptophan metabolism
    WK25_07445 (sucA)
Enzymes [BR:blat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     WK25_07445 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AOK04315
UniProt: A0A1B4NRK4
LinkDB All DBs
Position
1:1581866..1584730
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYDAYLNNPASVPENWREYFDALQNVPATDGSNAND
VAHFPIVESFAERAKANAFIPRESTSNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEGDLDQTYSASNLYFGFDQASLRDIVKGLRDTYCGTIGAEFMYI
SDPEQKRWWQERLESIRATPSFSADKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHAGKRGVQEIIIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEDGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLAIQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVITAEDADNYVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWVPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRNMARGDQPL
DWGMAEHLAFASLVASGYSVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAD
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGETDGGIDAKKVKRVLVCSGRVYY
DLVAHRREAKANDVAIIRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagtttcagctgaactcctatctgttcggcggcaatgcttcg
tacgttgaagaactgtacgatgcatacctcaacaatccggcatcggtgccggagaactgg
cgagagtatttcgacgcgctgcagaacgtacctgcaacggacggctcgaacgccaatgac
gtcgctcacttcccgatcgtcgaatcgtttgccgagcgtgcgaaggccaatgccttcatt
ccgcgcgaaagcaccagcaatctggcgaccgcgcgcaagcaggttcacgtccagtccctc
atcagcgcctatcgcttcctcggctcgcaatgggccaatctggatccgctgaagcgtcgc
gaacgtcccgccatccccgaactcgaacctgctttctacgacttctccgaaggcgacctc
gaccagacctacagcgcgagcaacctgtatttcggtttcgaccaggcttcgctgcgcgac
atcgtcaagggcttgcgcgatacgtactgcggcacgatcggcgccgagttcatgtacatc
agcgaccccgagcagaagcgctggtggcaggagcgcctggaatcgatccgcgcgacgccg
tcgttctcggccgacaagaagaagcacatcctgaatcgcctgacggcggcggaaggcctc
gagcgctatctgcacaccaagtacgtcggccagaagcgcttctcgctcgaaggcggcgaa
agcttcatcgcggcgatggacgaagtcgtccagcacgcgggcaagcgcggcgtgcaggaa
atcatcatcggcatggcgcaccgcggccgcctgaacgtgctcgtcaacacgctgggcaag
atgccggctgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggcaggc
gacgtgaagtaccacaagggtttctcgtccgacgtgtccacggaaggcggcccggtccac
ctgtcgctggcgttcaacccgtcgcacctcgaaatcgtgaacccggtcgtcgaaggttcc
gcgaaggcgcggatggaccgtcgcggcgacgaagacggcctgcaagtgctgccggtgcag
atccacggcgacgcggccttcgcgggccagggcgtcgtgatggaaacgctgaaccttgcg
cagacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtcggacccgcgcgatgcgcgctcgacgctgtactgtaccgacgtcgtcaag
atgatcgaagcgccggtgctgcacgtgaacggcgacgatccggaagccgtcgtgctcgcg
atccaaatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctgggtcacaacgagcaggacacgccggccgtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgtgcgctgtatgccgagaagctggtgcag
cagggcgtgatcaccgcggaagacgccgacaactacgtgaaggcttaccgcaaggcgatg
gacgacggccaccacaccgtggatccggtcctgtcgaactacaagagcaagtacgcggtc
gactgggttccattcctgaaccgcaagtggacggacgcagccgacacggccgtgccgctc
gccgaactgaagcgcctcggcgaacgcatcacgacggtcccggaaaacttcaaggtccac
ccgctcgtggagcgcgtgatcaacgaccgccgcaacatggcgcgcggcgaccagccgctc
gactggggcatggccgagcacctcgcattcgcgtcgctcgtcgcatcgggctactcggtg
cgcctgacgggccaggactcgggccgcggcacgttcacgcaccgtcacgccgtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacattgccgac
ggtcaggcgaagttcacggtgatcgactcggtgctgtcggaagaagcggtgctgggcttc
gaatacggttactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gacttcgtgaacggcgcacaagtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggtctcacgatgctgctgccgcacggctatgaaggccagggtccg
gaacactcgtcgacgcgtatcgagcgtttcctgcagctgtgcgccgatcacaacatgcag
gtcgtccagccgacgacgccggcgcagattttccacctgctgcgtcgccagatgatccgc
ctgttccgcaagccgctgatcgtcgcgacgccgaagtcgctgctgcgtcacaaggaagcg
gtgtcggacctgtcggaactcgcgaagggttcgttccagccggtgctgggcgagaccgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgctggtgtgctcgggccgcgtgtactac
gacctcgtcgcgcaccgccgcgaagcgaaggcgaacgacgtcgcgatcatccgtatcgag
cagctgtatccgttcgcgcacaagcagttcgaagccgaaatgaagaagtacgagaacgcg
actgaagtggtctgggtgcaggacgagccgcagaaccagggtccctggttctacgtcgag
caccacctgaaggaaggcatgaaggaagggcagaagctggcgtacagcggccgtccggct
tcggcctcgccggcggttggctactacgcgaagcactacgagcagcagaaggccctcatc
gaaggtgcgttcggccgcctgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system