KEGG   Burkholderia latens: WK25_08225Help
Entry
WK25_08225        CDS       T04819                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
blat  Burkholderia latens
Brite
KEGG Orthology (KO) [BR:blat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WK25_08225
Enzymes [BR:blat01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     WK25_08225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Glutaredoxin2_C Plant_NMP1
Motif
Other DBs
NCBI-ProteinID: AOK04451
UniProt: A0A1B4NS07
LinkDB All DBs
Position
1:complement(1767597..1768301)
Genome map
AA seq 234 aa AA seqDB search
MPDLSAFPITKKWPAQHPDRLQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDTNDQLSP
EFLSLNPNNKIPAIIDPNGPDGRPLPLFESGAILIYLADKTGQLIPKDLAGRYETIQWVM
FQMGGIGPMFGQVGFFHKFAGRDYEDKRPRDRYVAESKRLLGVLDAHLANRNWVMGDTYT
IADIAIFPWVRNLVGFYEAGDLVGFSEFRHVARALDAFVARPAVARGLNIPARD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatctgtccgccttcccgatcacgaaaaaatggccggcccagcatcccgaccgt
ctccagctttattcgttgccgacgccgaacggcgtcaaggtgtcgatcatgctcgaggag
accggcctgccgtacgagccgcacctcgtgcgcttcgacacgaacgaccaactgtcgccc
gaattcctgtcgctgaatccgaacaacaagattccggcgatcatcgacccgaacggtccc
gacggccggccgctgccgctgttcgaatcgggggcgatcctcatctatctcgcggacaag
actggccagttgatcccgaaggatctggcgggccgctacgagacgatccagtgggtgatg
ttccagatgggcggcatcggcccgatgttcggccaggtcggcttcttccataaattcgcg
ggccgcgactacgaggacaagcgtccgcgcgaccgctacgtcgccgaatcgaagcggctg
ctcggcgtgctcgacgcgcatctcgcgaaccgcaactgggtgatgggcgatacgtacacg
atcgccgacatcgcgatcttcccgtgggtgcgcaacctcgtcggcttctacgaggcgggc
gatctcgtcggcttcagcgagttccggcatgtcgcgcgagcgctcgacgcgttcgtcgcg
cgtccggccgttgcgcgcgggctcaatatcccggcacgcgactga

DBGET integrated database retrieval system