KEGG   Burkholderia latens: WK25_09825Help
Entry
WK25_09825        CDS       T04819                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
blat  Burkholderia latens
Pathway
blat00473  D-Alanine metabolism
blat01100  Metabolic pathways
blat01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:blat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    WK25_09825
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    WK25_09825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:blat01011]
    WK25_09825
Enzymes [BR:blat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     WK25_09825
Peptidoglycan biosynthesis and degradation proteins [BR:blat01011]
 Precursor biosynthesis
  Racemase
   WK25_09825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AOK04741
UniProt: A0A1B4NSS7
LinkDB All DBs
Position
1:complement(2117385..2118455)
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRLAGPSKVWAVVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTTVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYTPEKYRAAWERARACPGIGQITLMTHFSDADNERGVAEQLATFERGA
ENIAGARSLANSAAVLWHPDTHFDWVRPGIVLYGASPSGVSADIADTGLKPAMTLASELI
AVQTIAKGQAIGYGSTFLAQTQMRIGVVACGYADGYPRVAPEGTPVIVDGIRTRIVGRVS
MDMITVDLTPCPQAGIGARVELWGNALPIDDVARHCGTIGYELMCAVAARVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatctccgccaccatccataccgccgctctcgcgaacaatctctccgtc
gtccgccgccttgccggcccgtccaaggtctgggcggtcgtcaaggccaatgcgtacggc
cacggtctcgcgcgcgtgtttccgggcttgcgaggtaccgacggcttcggcctgctcgac
ctcgacgaggcggtgaagctgcgcgagctcggttgggccggcccgatcctgctgctcgaa
gggttcttccgctcgaccgacatcgacgtgatcgaccgttacagcctgacgacgaccgtc
cacaacgacgagcagatgcggatgctggagacggcgcggctgtcgaagcccgtcaacgtg
cagctgaagatgaacagcgggatgaaccggctgggttatacgccggaaaaatatcgcgcg
gcgtgggagcgcgcccgtgcgtgcccgggcatcgggcagatcacgttgatgacccatttt
tcggatgccgataacgagcgcggcgtcgccgagcagcttgcgacgttcgagcgcggtgcg
gaaaacattgccggtgcgcgcagcctcgcgaattcggccgccgtgctgtggcatccggat
acgcacttcgactgggtgcggccggggatcgtactctacggcgcatcgccgtcgggtgtg
tcggccgatatcgcggatacgggcctgaagccggcgatgacgctcgcgtcggagctgatt
gccgtgcagaccatcgcgaaggggcaggcgatcggctacggctcgacgtttctcgcgcaa
acgcagatgcgcatcggcgtcgtcgcgtgcggttacgcggacggctatccgcgcgtcgcg
ccggagggcacgccggtgatcgtcgacggcatccgcacgcggatcgtcggccgcgtgtcg
atggacatgatcactgtcgatctgaccccgtgcccgcaggccggcattggcgcgcgcgtc
gagctgtggggcaacgcgctgccgatcgacgacgtcgcgcggcattgcgggaccatcggt
tatgaactgatgtgcgcggtcgccgcccgcgtaccggtgcgcgcggaataa

DBGET integrated database retrieval system