KEGG   Burkholderia latens: WK25_12245Help
Entry
WK25_12245        CDS       T04819                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
blat  Burkholderia latens
Pathway
blat00020  Citrate cycle (TCA cycle)
blat00480  Glutathione metabolism
blat01100  Metabolic pathways
blat01110  Biosynthesis of secondary metabolites
blat01120  Microbial metabolism in diverse environments
blat01130  Biosynthesis of antibiotics
blat01200  Carbon metabolism
blat01210  2-Oxocarboxylic acid metabolism
blat01230  Biosynthesis of amino acids
Module
blat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
blat_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:blat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WK25_12245
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    WK25_12245
Enzymes [BR:blat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     WK25_12245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AOK05162
UniProt: A0A1B4NU24
LinkDB All DBs
Position
1:complement(2638902..2640158)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAHAYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGVKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGSEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGEVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggagggcggtgacaagatcaccgtcaacaaggac
ttctcgctcaacgtttccgatcagccgatcattccctatatcgaaggcgacggtacgggc
ttcgatatcacgccggtcatgatcaaggtggtcgacgcggctgtcgcgcatgcatacaag
ggcaagcgcaagatccactggatggagatcttcgcgggcgagaaggcgacgaaggtgtac
ggtccggacgtgtggctgccggacgaaacgctgcaagtgctgaaggaatacgtggtgtcg
atcaaggggccgctcacgacgccggtcggcggcggcatccgttcgctgaacgtcgcgctg
cgccaggaactcgacctctacgtgtgcctgcgcccggtccagtacttcaagggcgtgccg
tcgccggtgcgcgagccgcagaagatcgacatggtgattttccgcgagaactcggaagat
atttacgccggtatcgaatgggccgcgggctccgagcaggcgaagaaggtgatcaagttc
ctgcaggacgagatgggcgtgaagaaaatccgcttcccggaaacctccgggatcggcgtg
aagcccgtgtcgaccgaaggcaccgagcgtctcgtgcgcaaggcgatccagtacgcgatc
gacaacgaccgcaagtccgtcacgctcgtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggctacgcgctcgcgcagaaggaattcggcggcgaactgatc
gacggcggcccgtggatgcgcgtgaagaacccgaagacgggcagcgagatcgtcatcaag
gattcgatcgccgacgcattcctgcagcaaatcctgctgcgcccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcgctggccgcgcaggtcggc
ggcatcgggatcgcgccgggcgcgaacctgtcggactcggtcgcgatgttcgaggcaacc
catggcacggcgccgaagtatgcgggcaaggattacgtgaaccccggttccgagatcctg
tcggcggaaatgatgctgcgccacctcggctggacggaagcggccgatacgatcatcgcc
gcgatggaaaagtcgatcctgcagaagcgcgtcacgtacgacttcgcacgcctgatggaa
ggtgcgacgcaggtttcgtgctccggtttcggcgaagtgctgatcgagaacatgtaa

DBGET integrated database retrieval system