KEGG   Burkholderia latens: WK25_23150Help
Entry
WK25_23150        CDS       T04819                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
blat  Burkholderia latens
Pathway
blat00440  Phosphonate and phosphinate metabolism
blat01100  Metabolic pathways
blat01120  Microbial metabolism in diverse environments
blat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:blat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    WK25_23150
Enzymes [BR:blat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     WK25_23150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AOK07402
UniProt: A0A1B4P0E3
LinkDB All DBs
Position
2:complement(847722..849404)
Genome map
AA seq 560 aa AA seqDB search
MNAREPNFSESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHASETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNVR
GAGVERLKAMLATLQARPDFDTLDIPALLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGGNGSAQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttctccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcagcgatctcgaatttctgatggaagcgcacaacggcctgtccgcgcgtatcgtt
cgcgaagccggcttcaaaggcatctgggcctcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgacctgcccatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcattgccggcgtgtgcatcgaggac
aagcagttcccgaagacgaacagcttcatcgacggcgaacgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcaaagcgacccggacttctcg
atcgtcgcgcgtgtcgaagcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtacgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
cccgacgaaatcctgcagttcgcccgcgagtggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcatcggcgtccgcgatgcaggccaccgcgcgcgaa
atccacgcgagcgaaacgctgatcaacgtcgaggaccgcgtcgcgtcggtcaacgaaatt
ttccgcctgcaggacgccgacgaatactcggccgccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgccgcgattgtgctcgcggcgagccgcggcaagggactcgaggcc
gtcaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctcctgcgctgg
ctcgtcgacggcttcaagaagcacggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgatacgtcgggcatcaagctcgtcgtcaacgaacgtcatgcgcagacg
ggcgagctcgcgtcgctcgcgtgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaggccgag
ttcagcgtcgtcgtcgattcgtcgctcaccgaaaccaaccagagcgtgcgcgacttcgcg
ctgtgctcggccgctgacgaccgcggcctgttcggccagaagacgtatctgcaacgcgtg
tcgagcgacgttgccgccggcacgccgcatggccgctggatcggtcttctgaacgtgcgc
ggtgcgggcgtcgagcgcctgaaggcaatgctcgcgacgctgcaggcgcgcccggatttc
gacacgctcgacattccggcgctgttgaacgaactgatcgccgccggcgagaaaatcgag
gtgcagtacgtgcacggccactggcgcggtgtcaacgatctcgaggacttccgccgcgcc
ggcgacttcgcgcacggccagacgccgctgtccgagccgggcggcaacgggagcgcgcaa
tga

DBGET integrated database retrieval system