KEGG   Burkholderia latens: WK25_28550Help
Entry
WK25_28550        CDS       T04819                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
blat  Burkholderia latens
Pathway
blat00250  Alanine, aspartate and glutamate metabolism
blat00410  beta-Alanine metabolism
blat00640  Propanoate metabolism
blat00650  Butanoate metabolism
blat01100  Metabolic pathways
blat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:blat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    WK25_28550
   00650 Butanoate metabolism
    WK25_28550
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WK25_28550
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WK25_28550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:blat01007]
    WK25_28550
Enzymes [BR:blat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     WK25_28550
Amino acid related enzymes [BR:blat01007]
 Aminotransferase (transaminase)
  Class III
   WK25_28550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOK08719
UniProt: A0A1B4P458
LinkDB All DBs
Position
2:2100154..2101443
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAISDQLNSFTHTAYQIVPYASYVELAEKINARAPGDYPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADLMDAAAPGGLGGTYA
GNPLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEF
LKPGTGEPDADFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtc
ggcgtgatgtgcgatttctacgcagcccgcgccgagaacgcggagctgtgggatgtcgaa
ggccgccgcttcatcgatttcgccgccgggatcgcggtgctgaacacgggccaccgccac
ccgaagatcgtcaaggcgatctcggatcagctgaacagcttcacgcacaccgcttaccag
atcgtcccgtacgcgtcgtacgtcgagctcgcggaaaagatcaacgcgcgcgcgccgggc
gactacccgaagaagaccgcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatc
aagatcgcacgcgcggcgacgggccgtccgggcgtcatcgcgttctcgggcggcttccac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgaacttc
ggcccgttcccgggcgacgtgttccacgcaccgtatccgaatgcgctgcacggcgtgacg
acggccgactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgt
gtcgccgcgatcattttcgaaccggtccagggcgaaggcggcttcaacccggcgccggcc
gaattcgtgcgcgcgctgcgcaagatctgtaacgagcatggcatcctgctgatcgccgac
gaagtgcagaccggcttcgcgcgcaccggcaagctgttcgcgatgcagcactacgacgtg
ctggccgacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtc
gtcggccgtgcggacctgatggacgcggccgctcccggcggcctcggcggcacctacgcg
ggcaacccgctggccgtggcatcggcgcacgcggtgctcgagatcatcgacgaagagaag
ctgtgcgagcgcgcgacgcaactcggcgacgtactgaaggcgaagctgaacgcgctgcag
gcggacgtgccgcagatcgccgacgtgcgcggtccgggcgcgatgatcgcggtcgaattc
ctgaagccgggcacgggcgagccggacgccgacttcacgaagcgcgtgcaggcgcgtgcg
ctcgagcgcgggctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctg
ttcccgctgacgatcccgcaagccgtgttcgacgaagcgctcgtgatcctcgaggaagtg
ctgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system