KEGG   Blautia sp. N6H1-15: DQQ01_01940Help
Entry
DQQ01_01940       CDS       T05518                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
blau  Blautia sp. N6H1-15
Pathway
blau00473  D-Alanine metabolism
blau00550  Peptidoglycan biosynthesis
blau01100  Metabolic pathways
blau01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:blau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DQQ01_01940
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DQQ01_01940
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DQQ01_01940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:blau01011]
    DQQ01_01940
Enzymes [BR:blau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DQQ01_01940
Peptidoglycan biosynthesis and degradation proteins [BR:blau01011]
 Precursor biosynthesis
  Amino acid ligase
   DQQ01_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK ATP-grasp GARS_A ATPgrasp_ST GSP_synth ATPgrasp_YheCD GSH-S_ATP
Motif
Other DBs
NCBI-ProteinID: AWY97114
UniProt: A0A2Z4U8A6
LinkDB All DBs
Position
378963..379991
Genome map
AA seq 342 aa AA seqDB search
MNIVVLAGGNSTEREVSIASGQGICKALRERNHRAVMADPYFGMEKLEEDLFPAEYDIEE
AAEKMRKESALLEETMKSRRGFFGSNVLALCEKADIVFLALHGSNGEDGKVQSVLDLMGV
KYTGSNPLSSGMAMDKGITKMVFEANGVPTPKGITLEKGASSRLIDYGMEFPVVVKPCCG
GSSVGVFIVKNEAEYAQALLEAFSYEDKVVVEQYITGREFSVAVVDGKAYPVIEIAPIEG
FYDYKNKYQAGSCVETCPAEISASLTKEMQHYAEKGYEALKLQAYARLDFIMDEEGNMYC
LEANTLPGMTPTSLIPQEAKAIGMNYPQLCEKLIEVSLKKYQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagtagttttagcaggaggaaacagcacagaaagagaggtttccattgcctca
ggacagggaatttgcaaagcgttgagagagagaaaccaccgcgctgttatggcagacccg
tattttggtatggaaaagctggaggaagacttgtttcccgcagaatatgatatagaagaa
gcagcagaaaaaatgcgtaaagagagcgcacttctggaagaaaccatgaaaagccgcaga
ggatttttcggttccaatgtcctggctctgtgtgaaaaggcagatattgtttttctggcg
cttcacggctctaacggagaggacggaaaggtgcagtccgtgctggatttaatgggtgtt
aagtacactggatccaatcctttaagcagcggcatggcaatggataagggcattaccaag
atggtatttgaggcaaacggcgttcccacaccaaaaggaattaccctggaaaagggagcc
agcagccgtcttatagactatggcatggaatttcctgttgtggtaaagccctgctgcggg
ggctccagtgtaggtgtgtttattgtaaagaatgaagcagagtatgcacaggcgctttta
gaagcattttcctatgaagataaagttgtggtagagcagtatattaccggacgggaattt
tctgtggcggttgtggacggcaaggcttatccggtgattgagattgcgcctattgagggc
ttttatgattacaaaaataaatatcaggcaggctcctgcgtggaaacctgtccggcagaa
atctctgcttctcttacaaaggaaatgcaacattatgcagagaaaggctatgaggcttta
aaattacaggcctatgcaagactggattttattatggacgaagagggaaatatgtactgt
ctggaagccaatacccttccgggtatgacccccaccagtctgattcctcaggaagcaaag
gcgattggtatgaattatccgcagctttgtgaaaagctgattgaagtttctctgaaaaag
tatcagtaa

DBGET integrated database retrieval system