KEGG   Blautia sp. N6H1-15: DQQ01_02995Help
Entry
DQQ01_02995       CDS       T05518                                 

Definition
(GenBank) hydrolase
  KO
K03698  3'-5' exoribonuclease [EC:3.1.-.-]
Organism
blau  Blautia sp. N6H1-15
Brite
KEGG Orthology (KO) [BR:blau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:blau03019]
    DQQ01_02995
Enzymes [BR:blau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     DQQ01_02995
Messenger RNA biogenesis [BR:blau03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     DQQ01_02995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD tRNA_anti-codon HD_6 TraI_2 UPF0054
Motif
Other DBs
NCBI-ProteinID: AWY97291
UniProt: A0A2Z4U8D0
LinkDB All DBs
Position
578739..579710
Genome map
AA seq 323 aa AA seqDB search
MKFINELHEGEKLSGIYLCKHKQAAVTKNGKPYENVILQDKTGTIDAKIWDPNSLGIDEF
DSLDYIDVVGDVNSFQGSLQVSIKRVRKASEGEYEPGNYLPVSSQNPEVMYKSLLSYVAG
IKNPYLHRLLVSFFEEDEDFAKRFQGNSAAKSVHHGFIGGLLEHTLSVVNLCDYYCKTYP
ILNRDLLLTAAMLHDIGKTEELSPFPMNDYTDDGQLLGHIMIGAERIHDKAREIPGFPKK
LESELKHCILAHHGELEYGSPKKPALPEALALNLADNTDAKMETLTEMFASAGQQKEWIG
YNRLFESNFRKASCEQEGSVHGI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttattaatgaacttcacgaaggagaaaagctttccgggatttatttatgcaag
cacaagcaggcagcagtgacaaaaaacggaaagccttatgagaatgtaattttacaggat
aaaacaggaaccattgacgcaaaaatctgggatcccaattccctgggcattgatgagttt
gacagcctggactatattgatgtggtgggagatgtaaattcttttcagggaagtctgcag
gtcagcattaaaagagtccgcaaggcctctgagggagagtatgagccgggcaattatctt
cctgtgagcagtcagaatcctgaggtgatgtacaagagtctgttaagctatgtggcaggt
ataaaaaatccttatctgcacaggcttctggtgtctttctttgaggaggacgaggatttt
gcaaagcgctttcagggaaattcagcagcaaagagtgtacatcatggttttatcggcggt
cttttggagcataccttaagcgtggtgaacctgtgtgattattactgtaaaacataccct
attttaaacagggatttacttcttacggcagctatgctgcacgatatcggaaaaactgag
gaattaagcccattccccatgaatgattatacagacgacggacagcttttgggacacatt
atgataggagcggagcgaatccatgacaaagcccgggagattcctggctttccgaaaaag
ctggaaagtgagttaaagcactgcattttggcacatcacggagagctggagtatggttct
ccgaaaaaaccggcgctgccggaggctctggcgctgaatctggcagacaatacagacgcc
aaaatggaaactctcacagaaatgtttgcatcagcgggacagcagaaggaatggattggc
tacaatcgtctgtttgaatccaatttcagaaaagcaagttgtgagcaggaaggaagcgtt
catggaatttaa

DBGET integrated database retrieval system