KEGG   Blautia sp. N6H1-15: DQQ01_06810Help
Entry
DQQ01_06810       CDS       T05518                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
blau  Blautia sp. N6H1-15
Pathway
blau00040  Pentose and glucuronate interconversions
blau00051  Fructose and mannose metabolism
blau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DQQ01_06810
   00051 Fructose and mannose metabolism
    DQQ01_06810
Enzymes [BR:blau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     DQQ01_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_3 UDPG_MGDP_dh_N Pyr_redox_2 Glyco_tran_WecB Pyr_redox Peripla_BP_6 ADH_N_2 DAO Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AWY97901
UniProt: A0A2Z4UA30
LinkDB All DBs
Position
1388940..1389986
Genome map
AA seq 348 aa AA seqDB search
MKGKMKTAVMLDIGKMGFEEREIPTPKDNEVLVKLEYVGICGSDLHYYESGAIGDFVVKP
PFVLGHEPGGTVVEVGKNVTHLKVGDRVALEPGKTCGHCEFCREGKYNLCPDVEFFATPP
VDGVFQEYVAHEAGLCFKLPENVSTLEGALIEPLAVGFHAAIQGDAHLGQKAVVMGAGCI
GLVSMMALKARGVTEVYVVDIMDKRLEKATELGASGVINGAKEDVVKRIRELTEGKGVDL
VIETAGSEITTRQAVQITKKGAAIVLVGYSKSGEITLPMSLALDKELTFKTVFRYRHIYP
MAIDAVASGKVNLKGIVTDIFDLDEVQKAMDYSIHNKAEIVKGVIKIC
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtaaaatgaaaacagctgtcatgctggacattggaaaaatgggatttgaggaa
agagaaattcccacaccaaaggataacgaggttttggtaaagttggaatatgtgggcatc
tgtggcagcgatttgcattattatgaatccggagcaatcggagattttgtggtaaagccg
ccatttgtgctggggcatgaaccgggtggtacggttgtggaagttggaaaaaatgtaaca
cacttaaaagtgggggatcgggtggctttagaaccgggcaaaacctgtggacactgcgaa
ttctgtagagaaggaaaatacaatctctgtccggacgtggagttctttgccacaccccct
gtcgatggagtttttcaggaatatgtggcacatgaggcagggctttgcttcaagcttccg
gagaatgtaagcaccctggaaggagctttaattgaaccgctggctgttggtttccatgca
gccattcagggtgatgcgcatcttggacaaaaggcagtggttatgggggctggctgcatt
ggtctggtatctatgatggcattaaaggcaagaggggtcacagaggtttatgtggtagat
attatggacaaacgtttggaaaaagctacggaattaggtgcatcaggagtcattaacggc
gcaaaggaagatgttgtaaagcgcatcagagagctgacagagggaaaaggcgttgatttg
gttattgaaacagcaggaagtgaaattaccacaagacaggctgtgcagattacaaagaaa
ggcgcagctattgtgctggtaggatacagcaagagcggagaaattacactacctatgagc
cttgcgctggataaggaactgacctttaaaactgtattccgatatcgccatatttatccc
atggcaattgatgcggtagcttccggaaaagttaatttaaagggcattgtaacggatatt
tttgatttggacgaggtgcagaaagcaatggattacagtatccataataaggcagaaatt
gtaaaaggggtaattaaaatttgttaa

DBGET integrated database retrieval system