KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1581Help
Entry
BBMN68_1581       CDS       T01345                                 

Gene name
fimV
Definition
(GenBank) FimV
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA
Motif
Other DBs
NCBI-ProteinID: ADQ02619
LinkDB All DBs
Position
1976429..1977922
Genome map
AA seq 497 aa AA seqDB search
MSEWTVKINGVDRISVKPGECVEIGRKPLRPLADDGNTRLDVADQTKSMSKRHAMFTVKS
NGTASVRDLGSTNGSYVVRENGDLLRLPANAEFLLPTSPMRMQFGDVPADFIRVDDPVAK
PLDLKVPDLFGYAVHEAPQEPDAADMSVDDILDLRAGEPTAIFSADNVRRKVDELELGSL
NITQPVTKNDEPAIPRDLFADALAQHAEQETERKNQQAMNSVALPKQQTEPESTIVTPAS
KHSRISGIVPVDAIAHAVVKHAPSTSEPAVASAAVVESDVVAGASKSAENVQSAPNTRNA
GDSQPADTVEQHAEVAQPEAAREAEAAQSENTQPETAQPATAQSETDQPAADVPDDQQRT
AAEAYQEATAAGVADQQPAAETAQQSVSEAYDIDSTGVHTPVFEPGSVFERVAKGELKAQ
EPAVEVDGLTSDEAKTTQDFNVQFEVARHPELLAFLAMNPYLYDDMYSWLAARGEADIDE
ALSHNKGYQEYREAVGK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagtggacggtgaagatcaacggtgtcgaccggatcagcgtcaagccgggggag
tgcgtggaaatcggccgtaagccgttacgcccccttgccgatgatggcaacacccgcctt
gacgtcgccgatcaaaccaaatcgatgtccaaacggcacgccatgttcacggtaaaaagc
aatggcacggcctcggtccgtgatcttggatcgaccaatggatcgtatgtggtgcgggaa
aatggcgatttgttgcgcttgccggccaatgccgagttcctgttgccgacgtctcccatg
cgcatgcagttcggcgatgtgcctgcggacttcattcgtgtcgacgatccagtggcaaag
ccgctcgacctcaaggtgcctgatttgtttggctatgcggttcacgaagcaccgcaggag
ccggatgcggcggatatgtccgtcgacgatattcttgatttgcgggccggcgagccgacc
gccatcttcagcgcggataatgttcgacgcaaggtcgacgagcttgaacttggctcgctg
aatatcacgcagccagtgacgaaaaacgatgagccggccataccccgtgatctgttcgcg
gatgcgttggcccagcatgccgagcaggagaccgaacgcaaaaaccagcaggccatgaac
tccgtggcactgccgaagcagcagaccgaacctgagtcgacgattgtaacgcctgcatcc
aagcacagcaggatctccggtattgttccagtagatgccatcgcccatgccgttgttaag
cacgctcccagcacaagcgagccggcagtggcgtcggcggcggttgttgaatccgatgtg
gtggctggcgcaagcaagtcagccgaaaacgttcagtccgctccgaataccaggaatgcc
ggcgattctcagccggcggacactgtcgaacagcatgctgaagttgcccagcctgaagcc
gcccgggaagccgaagccgctcaatctgaaaacacccagcctgagaccgctcagccggca
accgcccagtctgaaaccgaccagccggcagctgacgtaccggacgatcagcagcggacc
gcagccgaagcatatcaagaagccaccgcagcaggcgtagcagaccagcagccggctgcc
gaaaccgcccagcagtcggtatccgaagcatatgatatcgactccacgggcgtacacact
ccggtcttcgagcccggctcggtgttcgagcgtgtggccaagggcgagctgaaagcacag
gagccggcagtcgaagtcgatggcctgacctctgacgaggcaaaaaccacgcaagatttc
aatgttcaattcgaagtcgcccgtcatcccgaattgctggcgttcctcgccatgaatccg
tacctgtacgacgacatgtattcttggctcgccgcccgtggcgaggccgatattgacgaa
gccctgtctcacaacaagggctatcaggaataccgcgaagcggttggaaagtga

DBGET integrated database retrieval system