KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1582Help
Entry
BBMN68_1582       CDS       T01345                                 

Definition
(GenBank) Hypothetical protein
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTES_1575
Motif
Other DBs
NCBI-ProteinID: ADQ02620
LinkDB All DBs
Position
1977931..1981554
Genome map
AA seq 1207 aa AA seqDB search
MTQSQTQNQNLTEGLNRIRRWRDQYRSMQPPSPLEDVNQLAAKLEMTHAHPSGIAQLFAS
GHVRLDSLFRDTGVLKAAERHIGRVLDDQAAKRRISGVAELSLVVGVATWKGNALPVLLY
PVSVTIEDDGLSTTIRFTGRVALNVAFVNTLREQGVFLDEDSLFDGASYDSGTPETSAMF
ARISSEASERISDFAIERQIVLGCFMDPSSQMISESRQFIDQLENGPTGNVLLDALAGDE
SARTALKDANIPQYSPFDVDPHAEYEVGDVDNTVRYAASLAANGHSIVVDGTFPKGTAEQ
AVAIASRCLMNGRSVLYVPGVAEQKRLFIQTASANEMKAQVLDVSDEHANAALDKQLIAA
VGFQPGVATQRFDQLADELVGVRSRLTRYLGDLHGGNDKWNVSAYETIQNLARISVLPTH
PATHVRLDESSALSIANDIDTWIGKMERAGELGEYTIGPEDTAWYKASITTEEQAVTAYQ
RVDDLLRRFLPATREQVARTVQTCGFPVPPTTREWERQVTVLKNLRRVLDVFQPEIFERD
ISSMIEATKPKSQRKAEGTSMGFWERRRHIKEAKDLLRVGAQVEDLHEALKVVAKQGEQW
HQFVPHGGWPVLPSKLDEIISTQEALVSNMTALDTVLSTTPAGGNLETADFEKVEARLKA
LLDDRKALDTLPERCLLEQEFASAGLNELVADLNARRVSVEQVRGEVQLAWWTTVFEDIV
RSSAIISNQDGAALQAASDRFAQVDVEHVRSIGPMVSQESMRRLCDMLFSRTQEANQMHT
VLAGRASVSLSRIRRDHPEILAAAKPILVAAPGTLAALTEPGVLADVAILDACAHIPAIE
LLSIIGRVQQVVVIAHCATVTSESVKQLIDTLPHIEVDAAPSRRAPRLSAFLESEGYGPV
RYDVATEPAAGEVRFHRVEASGVPVMSSGLVESSQPEIDEVVRLITQRAAGFAVVPSSYR
LVVVMLTDAFRTRLGAELKSLAGKSKAMGRFLRHVRLVSLRDVAGGRATDVILSMCYAKT
THGRLLQQFGPLESTGGRGLLLDALALADHSLDIVSAFGSEDLDEERLHQSGPRFLKTML
TWAEQLDDRPVLPLRDAAGGNVLFDDIADRLRARGLNAAVDYGFDKGVKIPLVVGLKDKP
FALAVQTDDANFMSVQSTRRRHRLSAQDLISLGWNVMTVWSVAAFVNPDKEVDRIVSRIG
EIYREVE
NT seq 3624 nt NT seq  +upstreamnt  +downstreamnt
atgacccagagccagactcagaaccagaatctcacggaaggtctgaatcgcatccgtcgc
tggcgtgaccaataccgcagcatgcagccgccatcgccgctcgaggatgtgaatcaactg
gccgcgaagctggagatgacccatgcccatccctccggcatcgcccagctgttcgcttcc
ggccatgtccggttggattcgttgttccgcgacacgggtgtgcttaaggccgccgaacgc
catattgggcgcgtgctggatgaccaggccgccaaacgcaggatttccggcgtggcggag
ttgtcgctcgtggtcggcgtggccacatggaagggcaacgcgctgccggtgctgttgtac
ccggtgagcgtcacgatcgaggatgatggcttgtcgaccaccattcgattcaccggtcgc
gtggccctgaacgtcgcgttcgtcaatacattgcgtgagcagggggtgttcctggatgag
gattccctgtttgacggtgccagctatgacagtggcactcccgaaacttccgcgatgttc
gcccgtatttcgtccgaagcgtcggagcgtatctccgacttcgccatcgagcgccagatt
gtgctcggatgcttcatggacccctcgtcgcagatgatcagcgaaagccgacagttcatc
gaccagctggagaacggccccaccggcaatgtgctgttggacgcgcttgccggcgacgaa
tccgcccgcaccgcgctcaaagatgccaatattccgcaatacagtcctttcgacgtagac
ccgcatgccgagtacgaagtcggcgatgtggacaatacggtgcgatatgccgcgtcactt
gctgccaatggccatagcatcgtggtcgacggcaccttcccgaagggcaccgcggagcag
gctgtggccatcgcatcgcgctgcctgatgaatggtcgttccgtgctgtacgtgcccggc
gtggccgagcagaagcgtctgttcatccagacggcttccgccaatgagatgaaggcgcag
gtactggatgtatccgatgaacacgccaacgccgcgcttgataagcagctgattgccgca
gtcggattccagcccggagtcgccacccagcgattcgaccagctggccgacgaactcgtg
ggcgtgcgctcgcgcttgacccgctatctgggcgacctgcacgggggcaacgataagtgg
aatgtgtccgcatacgagaccattcagaatctggcccgtatctccgtgctcccgacgcac
cctgccacccacgttcgacttgacgagtcaagtgccctgagcatcgccaacgatattgac
acatggatcggcaagatggaacgcgccggcgagctcggcgaatacaccatcggcccggaa
gacaccgcatggtacaaggcgtccatcaccactgaagaacaggcagtaaccgcctaccag
cgcgtggacgatttgctgcgtcgcttcctgcccgccacccgtgagcaggtggcacgcacc
gtgcagacctgcggattcccggttcctcccaccacccgcgagtgggagcgtcaggttacg
gttttgaagaatctgcgacgagtgcttgacgtgttccagccggagattttcgagcgagac
atcagctccatgatcgaggccaccaagccgaagagccagcgcaaggccgagggcacgtcg
atgggattctgggagcgccgccgccacatcaaggaagccaaggatctgctgcgcgtcggc
gcgcaggtcgaggacttgcacgaagcgttgaaggtagtcgccaagcaaggggagcagtgg
catcagttcgtgcctcacggcggttggccggtgctgcccagcaagctcgacgagatcatc
tccacccaagaggcgctggtcagcaatatgaccgcgctggataccgtgctttccaccaca
cccgctggtggcaatctggaaaccgccgatttcgagaaggtggaagcacgcctgaaagca
ctgctggatgatcgcaaggcactggacaccttgccggagcgttgcctgctggagcaggaa
ttcgcctctgccggactgaacgaactggtcgccgatctcaacgctcgccgagtgagcgtg
gagcaggtgcgcggcgaagtgcagctggcctggtggaccaccgtgtttgaggacattgtg
cgttcgtccgccatcatctccaaccaggatggtgccgcgctgcaggccgcatccgaccgc
tttgcgcaggtcgatgtggagcacgtgcgctccatcggaccgatggtgtcgcaggaatcc
atgcgccgcctgtgcgacatgctgttctcccgcactcaggaagccaaccagatgcacacc
gtgctggcagggcgcgccagtgtgtcgctgagcaggattcgccgtgatcatccggagatt
ctggccgcggccaagccgattctggtggccgcgccgggtacgctcgccgcactcaccgag
ccgggtgtgctggctgatgtggcgattctcgatgcgtgcgcgcacattcccgctatcgag
ttgctgtccatcatcggccgcgtgcagcaggtggtggtgatcgcccactgcgcgacggta
accagcgaaagcgtcaagcagctgatcgacacgttgcctcatatcgaggtggatgctgcc
ccgtctcgccgtgcgccgcgcctgtccgcattccttgaatccgagggatatggtcctgtt
cgctatgatgtggccaccgagccggctgccggtgaggtgcgattccaccgtgtggaagcg
agcggtgtgccggttatgtcttctggtctggtggaatccagccagccggagattgatgaa
gtggtgcgtctgattacgcaacgtgccgccggttttgccgtggttccttccagctatcga
cttgtggtcgtgatgttgaccgacgcattccgcacacgcttgggtgccgaattgaagtcg
ttggcaggcaaatccaaggcgatgggccgattcctgcgccatgtgcggttggtttccttg
cgtgacgtggccggaggtcgtgccactgacgtgattctgtcgatgtgctatgcgaaaacc
acgcacggacgtctgcttcagcagttcggtccgctcgaaagcacaggcggtcgcggactg
ttgctggatgccctggcattggcggaccacagcttggatattgtgtcggcctttggttcc
gaagatttggatgaagaacgtctgcaccaatccggtcctcggttcctgaagaccatgttg
acgtgggccgaacagcttgacgaccgtccggtgcttccgttgcgtgatgcggcaggcggc
aacgtgctgttcgacgatatcgccgacaggttgcgcgcgcgaggactgaacgctgctgtt
gattatggattcgacaagggcgtgaagattccgctcgtggtgggattgaaggacaagccg
tttgccttggccgtgcagaccgatgacgcgaactttatgtccgtgcaatccacgcgtagg
cgtcatcgtttgtcggcacaggatctcatttccttgggctggaatgtgatgaccgtctgg
agtgtcgccgccttcgtgaaccccgataaggaagtcgaccgtatcgtcagccgtatcggt
gagatctatcgcgaggttgaataa

DBGET integrated database retrieval system