KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1583Help
Entry
BBMN68_1583       CDS       T01345                                 

Definition
(GenBank) Hypothetical protein
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADQ02621
LinkDB All DBs
Position
1981557..1981757
Genome map
AA seq 66 aa AA seqDB search
MAEYSATRRTPRKHKRVVMKGTEQFDADGVKLEPGDMQTDQQRQSDDDKRILGELPPHWA
VFNERE
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatactcggctacacggcgcacaccgcgcaagcacaagcgcgtggtgatgaag
ggcactgagcagtttgacgctgacggtgtcaaactcgagcccggagacatgcagaccgac
caacaacggcaatccgacgacgacaaacgcatcctcggcgaactgccgccgcattgggcc
gtttttaacgagcgcgagtag

DBGET integrated database retrieval system