KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1584Help
Entry
BBMN68_1584       CDS       T01345                                 

Gene name
flgA
Definition
(GenBank) FlgA
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAF ChapFlgA
Motif
Other DBs
NCBI-ProteinID: ADQ02622
LinkDB All DBs
Position
complement(1981852..1982421)
Genome map
AA seq 189 aa AA seqDB search
MADALRRLTAALCVGLAVLFGLEAVLAVVETEPMVVAARSIRRGDIILAADVQLADMPVS
AAGPSWTGNIEDVVGKVAQIDIEAADPISTHMARDAPVAPTGTTVIEVRLASSVDDVLAG
DQVRLVSAVGCEGADCTLAENATVMNVGKPDAIGALGGNDRLVSFAMPPEAAAKVMELQQ
AGAIMAVVR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgccttgcgccgactcactgctgcgttgtgcgtgggactcgcagtgctgttt
gggcttgaagccgtattggccgtggtggagaccgagccgatggtggtggccgcccgctcg
attcgacggggtgacattattctggccgccgacgttcagttggctgatatgccggtatct
gcggcaggcccgtcttggacaggcaatattgaggatgtggtgggcaaggtagcgcaaatc
gatatcgaagcagccgatcccatttccacgcatatggccagagatgcgcccgtagcaccg
accggcactacggtgattgaagtccgcttggccagtagcgtcgacgatgtattggccggc
gatcaggtgagactggtttccgctgtcggttgcgaaggcgctgattgcacgctggccgag
aacgccacggtgatgaatgtcggcaaaccggatgcgattggtgcattgggaggcaacgac
cgactggtgtcgttcgcaatgccgccggaggccgcggccaaggttatggagctgcaacag
gccggagcgattatggccgttgtgcggtag

DBGET integrated database retrieval system