KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1585Help
Entry
BBMN68_1585       CDS       T01345                                 

Definition
(GenBank) Hypothetical protein
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn-ribbon_8 HypA Prok-RING_1 TFIIS_C zf-UBR zf-CSL NOB1_Zn_bind Zn_Tnp_IS91 PhnA_Zn_Ribbon Rubredoxin_2 zf-C2H2 NRDD DZR DUF1178 DUF1451 Zn_Tnp_IS1595 DUF983 Rubredoxin
Motif
Other DBs
NCBI-ProteinID: ADQ02623
LinkDB All DBs
Position
complement(1982659..1982844)
Genome map
AA seq 61 aa AA seqDB search
MPTYHYRCKNCGYDFTEQQSFNDDPITVCPKCSQEQVRKVYSAVPIEFKGHGFYRTDKSG
K
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
ttgcctacctatcattaccgttgcaagaactgcggctatgacttcaccgaacagcagtcg
ttcaatgacgacccgattaccgtgtgccccaagtgctcgcaggagcaggtgcgcaaggtg
tattccgccgtgccgattgagttcaagggtcacggcttctaccgcaccgacaaatccggc
aagtaa

DBGET integrated database retrieval system