KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1587Help
Entry
BBMN68_1587       CDS       T01345                                 

Gene name
rimL2
Definition
(GenBank) RimL2
  KO
K03790  [ribosomal protein S5]-alanine N-acetyltransferase [EC:2.3.1.267]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Brite
KEGG Orthology (KO) [BR:blb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:blb03009]
    BBMN68_1587 (rimL2)
Enzymes [BR:blb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.267  [ribosomal protein S5]-alanine N-acetyltransferase
     BBMN68_1587 (rimL2)
Ribosome biogenesis [BR:blb03009]
 Prokaryotic type
  ribosomal protein modification factors
   BBMN68_1587 (rimL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_1 Acetyltransf_4
Motif
Other DBs
NCBI-ProteinID: ADQ02625
LinkDB All DBs
Position
1983814..1984479
Genome map
AA seq 221 aa AA seqDB search
MATIKAVSVFQSIKEAFKLDHQIRPPRLTHPGFPIILRPLTMDDEDGWNEVRWRNNDWLA
PWESGDPMHGGSITFNQWVQRQRRNEQHGVGVIFAIEYQMRIVGQISLGAIVYGAMRTGV
VGYWVDQRCAGRGFAPMALAMLADWALGDPFGPALHRLEIAILPDNARSLAVVRKVGAHH
EGLRERYMYVNGQWRDHVTFALLAEDMGQGFAARLAAAGSR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctacaataaaggccgtgtcagttttccagtcgattaaagaggcgttcaagctggac
caccagatccgtccgccgcgcctcacccatcccggtttcccgataatcctgcgccccctg
accatggacgatgaggacggctggaacgaagtgcgctggcgcaacaacgactggctggcg
ccttgggaatccggcgacccgatgcatggcggctccatcaccttcaatcaatgggtgcag
cggcagcgccgtaacgagcagcatggcgtcggcgtgatcttcgccatcgaataccagatg
cgtatcgtcggccagatttcgttgggagccatcgtgtatggtgccatgcgtaccggcgtg
gttggttattgggtcgatcaacggtgcgccggccgcggattcgcgccaatggcactggcc
atgcttgccgattgggcgctcggagacccattcgggcccgcgttgcatcggctggaaatc
gccattctgccggataatgcgcgttctttggctgtggtgcgtaaggtcggagcccatcat
gagggactgcgcgagcggtatatgtatgtcaatggccagtggcgtgaccacgtaacgttt
gcgctgttggctgaagatatggggcaagggttcgccgctagactcgccgccgccggttcc
agataa

DBGET integrated database retrieval system