KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1588Help
Entry
BBMN68_1588       CDS       T01345                                 

Definition
(GenBank) Membrane-associated protein
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 ESCRT-II Clr2
Motif
Other DBs
NCBI-ProteinID: ADQ02626
LinkDB All DBs
Position
1984590..1985984
Genome map
AA seq 464 aa AA seqDB search
MLVIVAIIIVVWLPVRTANGMKRVDEHRQDRYSPSLHIVDAENGRRFGDIKPHKAKGAAM
PASTPSARLTSEHIAHVRELRRAAIRRRQILAVCLLAITVLVFAVSFPLHFSPLLALIPF
VLLLLVLVLGANASRQARQWERKVVRYERAHSGTGWSKKPSAESKDSKRVNKAEPVAAVT
APAEKPAEQIEDAATEVMEQRQIRRALRDAEIEQAKAKALRQSAAAYQAAEEHAKQSEKS
DIAQSAADKPAAEPSAMVDESADRKSAAETSESSATPDASVRTDKSIESDKSVAPRVEPS
LTVRDERDERDDAAAAADATSELVSVRPARALDVFDMSTSQDLISFTLGGEHNADNAPES
LEIKSTRQVSKAEPVEPAVAEKLIDEARAVKAADDAKAVSAGNAVDTEPEQRDDADTDAD
DEAANAAQRAAFHESEERADVEAPAATTDSLGAGLDSILARRGN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtgattgtggcgattattatcgttgtatggctgcccgtacgtacggccaacggc
atgaaacgtgtggacgagcaccggcaggatcgttattcgccttccctgcatatcgttgat
gcagagaacggcagacgattcggagacatcaagccgcataaggcgaaaggggcagcaatg
ccagcatcaacaccgtcagcgaggctgacatctgagcacatcgcccatgtgcgggaactg
cgccgcgcggccatccgccgccggcagattctcgccgtatgcctgcttgccataaccgtg
ttggtgtttgccgtatcgttccccctgcatttcagtccgctgcttgctcttattccgttc
gtgctgttgctgctggtgctggtgctgggagccaatgcctcacgccaggcccggcaatgg
gagcgcaaggtggtccgctacgagcgggctcatagcggtacgggctggtccaagaaaccg
tctgccgagtccaaggacagcaagcgtgtgaacaaggccgaaccggttgcggccgtaact
gcgcctgccgagaagcctgctgagcagattgaggatgctgccaccgaggtcatggaacag
cggcagattcgccgcgcgttacgcgatgccgagattgagcaggccaaggccaaggcgttg
cgtcagtccgccgccgcatatcaggccgcggaagagcacgccaaacagtctgagaagtct
gatattgcacagtccgccgccgataagcctgccgccgagccgtctgctatggtcgatgaa
tccgccgaccgtaagtccgctgccgaaaccagcgaatcttccgccacacctgatgcctcc
gttcgcacagacaagtcgattgagtcggacaagtccgtcgcccctcgagttgaaccatcg
cttacggtgcgtgacgagcgcgatgagcgcgacgatgccgctgccgctgccgatgccacg
tcggaactggtcagcgtacgccctgcccgagcactggacgtcttcgatatgtccacctcg
caggatctcatctccttcactttgggtggggaacataacgccgacaacgctccggaaagc
ttggagatcaagtcgacccgtcaggtgtccaaggcggaacctgtcgaacccgcagtggcg
gaaaagttgattgacgaggcccgagccgtcaaggccgcggacgacgccaaggctgtcagc
gccggaaacgctgtagacactgagccggagcagcgcgatgatgccgatacggacgccgat
gacgaggctgcaaacgccgcccagcgagccgcattccacgaatccgaggagcgtgccgac
gtcgaagcgccagcggcgaccaccgattcgttgggcgcaggcctggactccattcttgcc
cgccgcggcaactga

DBGET integrated database retrieval system