KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1589Help
Entry
BBMN68_1589       CDS       T01345                                 

Gene name
groS
Definition
(GenBank) GroS
  KO
K04078  chaperonin GroES
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Brite
KEGG Orthology (KO) [BR:blb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:blb03110]
    BBMN68_1589 (groS)
   03029 Mitochondrial biogenesis [BR:blb03029]
    BBMN68_1589 (groS)
Chaperones and folding catalysts [BR:blb03110]
 Heat shock proteins
  HSP10
   BBMN68_1589 (groS)
Mitochondrial biogenesis [BR:blb03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    BBMN68_1589 (groS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn10
Motif
Other DBs
NCBI-ProteinID: ADQ02627
LinkDB All DBs
Position
1986157..1986450
Genome map
AA seq 97 aa AA seqDB search
MSIKLTPLEDKIIVKQAEAQTQTASGLYIPDNAKEKPQQGEVLAVGPGRRDDKGERIPMD
VKVGDKVLYSKYGGTEVHYEGEDYLIVGARDILAILG
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgattaagctcacaccgttggaagacaagatcatcgtcaagcaggccgaggcccag
acccagaccgcttccggtctgtacattccggacaatgccaaggagaagcctcagcagggt
gaagtcctggccgttggcccgggccgtcgtgacgacaagggcgagcgcatcccgatggat
gtcaaggtcggcgacaaggtgctgtactccaagtacggcggcaccgaagtccactacgag
ggtgaggactacctcatcgtcggcgcccgcgacattctcgccatcctcggctga

DBGET integrated database retrieval system