KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1590Help
Entry
BBMN68_1590       CDS       T01345                                 

Definition
(GenBank) Possible cystathionine gamma lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
blb00270  Cysteine and methionine metabolism
blb00450  Selenocompound metabolism
blb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BBMN68_1590
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BBMN68_1590
Enzymes [BR:blb01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     BBMN68_1590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Met_gamma_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADQ02628
LinkDB All DBs
Position
complement(1987124..1988356)
Genome map
AA seq 410 aa AA seqDB search
MASDLVHHGQSFDDQPLGFGTLAIHLGNGVDAETGAIRRPITLANAYALPYDPSDINWSS
SDVNLYTRNGHPNQRYLEEKLARLEGAEDAVVLASGVAALAATFTTFLNRGDHAIFSDTT
YIAAYRLLNQILPEKYGIETSILDTSDPENVRAALRPNTKLVHIETPANPTLKVSDIATI
AKLAHEANPDILVSVDNTFNTPYNVRPLDLGADIVIESLTKYINGHGDALGGSIATTKAR
TDQIRFTAQVNFGGIISPFNAWLINRGSVTLPLRIRQHNALALAIAKHLESLDVVRFVAY
PGLESHPHHEVAVSQLARPDSGFGGVLSFGLDTNHDGHTRFVSKLNVITSAVSLGHDESL
IVFLGEDDERQYLYPPEFHRGFFRLAVGLEDTDDLIRDIDHALVEAGFEV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgatcttgtacatcacggacaatcattcgacgaccagccgctcggattcggc
acgctggccattcacctcggtaacggggtcgacgccgaaaccggcgcgatccgtcgcccc
atcacgctggcgaacgcctacgcgctgccctacgacccctcggacatcaactggtccagt
tcggacgtgaacctctacacgcgcaacgggcatccgaaccagcgctatctggaagaaaag
ctggcccgtcttgaaggtgccgaggatgcggtggtgctcgcttccggcgtggccgcgctg
gccgccacgttcaccacgttcctcaaccgaggcgaccacgcgatcttctccgacaccacc
tatatcgccgcctaccgcctgttgaaccagattctgccggagaagtacggcatcgaaacc
tccatcctggatacctccgatcccgagaacgtacgcgcggcgcttcgccccaacaccaag
ctggtgcatatcgagacaccggcgaacccgacgctcaaggtctcggacatcgccaccatc
gccaaactggcccacgaagcgaacccggacattctggtttcggtggacaacaccttcaac
acgccgtacaacgtgcgcccgctcgatctcggcgcggatatcgtcatcgaatcgctcacc
aaatacatcaacggccatggcgacgcgctgggcggctcgatcgccaccaccaaggcgcgc
acggaccagatccgcttcaccgcgcaggtgaacttcggcggcatcatctcgccgttcaat
gcctggctgatcaatcgcggctcggtgacgctgccactgcgcatccgccagcacaacgcc
ttggccttggcgattgccaagcatctcgaatcgctggatgtggtgcgtttcgtggcgtac
cccggtctggaatcgcacccgcaccacgaggtggcggtcagccagctggcccgcccggac
tccgggttcggcggcgtgctgtcgttcggcctcgacaccaatcatgacgggcacacccga
ttcgtttccaagctcaatgtgattacgtcggccgtctcgctcggccatgacgaatcgctg
atcgtgttcctcggcgaggatgacgagcgccagtacctgtacccgcctgagttccaccgc
ggcttcttccgtctggccgtgggtctggaggatacggacgatttgattcgcgacatcgat
cacgcgctggtggaggccggattcgaggtgtga

DBGET integrated database retrieval system