KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_832Help
Entry
BBMN68_832        CDS       T01345                                 

Gene name
norM3
Definition
(GenBank) NorM3
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MatE Polysacc_synt_C DUF4133
Motif
Other DBs
NCBI-ProteinID: ADQ03581
LinkDB All DBs
Position
complement(956708..958066)
Genome map
AA seq 452 aa AA seqDB search
MVQVHGIRRASADAKYRQMTGQPVKPLILKLCLPAVISNLVTTAYNLTDTFFIGQLGTAQ
SGAIGIAFSIMTVMQALGFFFGNGAGNSMSRELGKQNNDRASRLLAVGFAGAVLSGLVIA
AIGLLTLRPLVVMLGSTSTIAPYAVQYLTPLLVAAPCVCGSFALNGLLRYQGQSAFGMIG
LVSGALLNFLLAPLFIFMAGLGIFGAGLATAICQTVSFAILTTMSRKFGVMKLSLRNCRP
DVLLMREVAGGGLPSLIRQGAGSISVTCVNIAANPFGDAAIAGMAIVMRIMLGANSVIVG
LGQGFQPVCGYNYGAGLFARVKEGYWFCVRLATCVLVALAALLWIFAPQLVEIFRSDPAV
VAVGVAALHIQCCTVILNGFNMMGNMMTQTMGRTGIASFLALCRQGLFLAPIVLVLPMIF
GVLGVEMAQSVSDVLTFVVTIPFMRRILHELR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggttcatggtattagacgcgcaagcgcggacgcgaaatatcggcagatgacc
gggcagccggtcaaaccgctgatcctcaaactatgcctgccggccgtcatttccaatctg
gtgactactgcatacaacctgactgacacctttttcatcggccagctcggcaccgcgcag
tccggtgctatcggcatcgcgttctccatcatgaccgtgatgcaggcgctcggcttcttc
ttcggcaacggcgcgggcaactcgatgagccgcgaactcggcaagcagaacaatgatcgc
gcctcccgactactggccgtgggcttcgcgggcgcggtgctctctggtttggtgattgcc
gcaatcggattgctgaccctgcggccacttgtcgtcatgctgggctcgacctcgacgatc
gccccatacgccgtgcaatatctgacgccgttgctggtcgccgcaccctgcgtgtgcggt
tcgttcgcactcaacggattgttgagataccaaggtcaatcggcgttcggcatgattggt
ctggtgtcgggcgcactgctgaatttcctgcttgcgccattgttcattttcatggccggt
ctggggattttcggtgccggcctcgccaccgccatctgccagacggtgagcttcgcgatt
ctgaccacgatgagccgcaaattcggcgtaatgaagctgtccttgcgcaattgcaggccg
gatgtgctgctcatgcgcgaagtggccggcggcggcctgccttcgctgatccgccaaggc
gccggctcgatttccgtgacttgcgtgaacatcgccgccaacccgttcggcgacgcggcc
atcgccggcatggccatcgtgatgcgcatcatgttgggcgccaattcggtgatcgtgggt
ctcggccaaggtttccagccggtgtgcggctacaactacggggccggcctgttcgcgcga
gtcaaagagggatattggttctgcgtgcggctcgccacctgcgtgctcgtggcgttggca
gcgctgctgtggattttcgcgccgcaactggtcgagatcttccgttccgacccggccgtg
gtggcggtgggcgtggccgcgctgcatattcaatgctgcacggtgattctcaatggcttc
aacatgatgggcaatatgatgacccagaccatgggccgcaccggcatcgcctcgtttctg
gccttgtgccggcaaggcctgttcctggcaccgattgtgctggttctgccgatgatattt
ggcgtgcttggtgtggagatggcgcaatcggtgtccgacgtgctgacattcgtggtcacc
atcccgttcatgcggcgaatcctgcacgaattgcggtga

DBGET integrated database retrieval system