KEGG   Bifidobacterium animalis subsp. lactis Bl-04: Balac_1566Help
Entry
Balac_1566        CDS       T00923                                 

Definition
(GenBank) putative glycosilase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
blc  Bifidobacterium animalis subsp. lactis Bl-04
Pathway
blc00500  Starch and sucrose metabolism
blc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Balac_1566
Enzymes [BR:blc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Balac_1566
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Balac_1566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ACS46907
LinkDB All DBs
Position
1845783..1847387
Genome map
AA seq 534 aa AA seqDB search
MSSSHQVPQWLDQATFYEIYPQSFADSNADGIGDIPGIIEHLDYLLQLGCNAIWLNPLYE
SPFRDAGYDISDYKKVAARYGTNDDLAALFAAAHARGMHVLLDLVPGHTSNEHPWFRQSA
TDSPNLYDDRYIWTGNWIEGGDGLPFIGGEEARDGAYIVNFFAFQPALNYGFAHPRKGWQ
APALGDEALRTCDAMLDVMRFWLDMGADGFRVDMADSLVKGDDEGKPYTIRTWQYMLGQI
RGEYPEAAFVSEWGRPDEAFEAGFDMDFYLDWRWDGVANGYSMLLRDTDTPMLRDGDHSY
FNADSGTSIVPFLGEYEPRLEAARKAHAYFDLITCNHDTMRLVPRLTTRELALAYSTIFL
MPGVPFIYYGDEIGMRYRNLPGKEGGYTRTGSRTPMQWDNSANHGFSQAAADALYLPVDE
REDAPTVAAAVADGNSLWHHMHAALEQRRSTPAFAPDADFSVLFAEEGRRPFVFKRAKDG
VSAIVAVNPGRDGETVTLPDDDGSETRTITLNIGGAVLDGTTLTLPPQSFAVLQ
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagtcaccaggttccgcaatggctcgaccaagccacgttctacgagatctac
ccacagagcttcgcggactcgaacgccgacggcatcggagacatccccgggatcatcgaa
cacctcgattacctgttgcaactgggatgcaacgcgatctggctcaacccgctctacgag
tcaccgttccgcgatgccggctatgacatcagcgactacaagaaagtggccgcacgctac
ggcaccaacgacgatctcgccgcactgttcgccgcggcgcacgcacgcggcatgcacgtg
ctgctcgacctcgtgcccggccatacgtcgaacgagcacccgtggttccgccaaagcgcc
acggattcgccgaatctgtacgacgaccgctacatctggaccggcaactggatcgagggc
ggcgacggactgccgttcatcggcggcgaggaggcgcgcgacggcgcgtacatcgtgaac
ttcttcgcattccaaccggcactcaactacggtttcgcccacccgcgcaaaggctggcag
gcaccggcactcggcgacgaggcgctgcgcacctgtgacgcgatgctcgacgtgatgcgc
ttctggctcgacatgggggccgacggcttccgcgtggacatggccgacagcctggtgaaa
ggcgacgacgaaggcaagccgtacacgatccgcacctggcagtacatgctcggacagatt
cgcggggagtaccccgaagccgcattcgtctcggaatggggacgccccgacgaggcgttc
gaggccggcttcgacatggacttctacttggattggcgttgggacggcgtagccaacggc
tatagcatgctgctgcgcgacaccgacacccccatgctccgcgatggcgaccacagctat
ttcaacgccgattccggcaccagcatcgtgccgttcctcggcgaatacgaaccccggctc
gaagcggcgcgcaaggcgcatgcctacttcgacctcatcacctgcaaccacgacaccatg
cgtctggtgccgcgcctgaccacccgcgagctggccctggcctacagcacgatcttcctg
atgccgggtgtgccgttcatctactacggcgacgagatcggcatgcgctaccgcaacctg
cccggcaaggagggcggctacacgcgcacgggttcgcgaacgcccatgcagtgggacaac
agcgcgaaccacggcttctcgcaagccgctgccgacgccctctacctgcccgtggacgaa
cgcgaagacgcgccgacagtcgcggcggccgtcgccgacggcaactcgctctggcaccat
atgcacgcggccctcgaacagcgcaggagcaccccggcctttgcgccggatgcggacttc
agcgtgctgttcgccgaggaaggcaggcgccccttcgtgttcaagcgcgcgaaagacggc
gtctccgccattgtggcggtcaatccggggcgcgacggcgagaccgtgacgctaccggat
gacgacggctccgagacgcgcaccatcacgctgaacattggtggggcggtactcgatggc
acaacgctcacgctgcccccgcaatccttcgccgtgctgcagtga

DBGET integrated database retrieval system