KEGG   Blattabacterium sp. (Cryptocercus kyebangensis): DM815_02270Help
Entry
DM815_02270       CDS       T05708                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
blck  Blattabacterium sp. (Cryptocercus kyebangensis)
Pathway
blck00564  Glycerophospholipid metabolism
blck01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blck00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DM815_02270
Enzymes [BR:blck01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DM815_02270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Thi4 Pyr_redox_2 HI0933_like Pyr_redox_3 NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AWU44034
UniProt: A0A2Z4AU14
LinkDB All DBs
Position
456313..457917
Genome map
AA seq 534 aa AA seqDB search
MRKGFLNRDRFLRILENINTWDIVIVGGGATGLGIALDSAYRGYKTLLLEQNDFSKGTSS
RSTKLIHGGIRYLAQGNIKLVYEALQERGFLLKNAPHLVKKKRFVIPIFSWKTGVFYWTG
LKIYEWLSGSLSFGNSQFLSKNEILKMFPEIRPNNLKGGILYYDGQFDDARLAIDLAQTC
VQQGGVLLNYFKVKNLIKKIENKISGVIAYDLETKKKYSIYSKVVINATGVFSDSILKMD
DSTCPILIKPSQGTHIVLKKSFFSSSDAIVIPKTSDGRILFSIPWYDHVLVGTTDTFLDK
SILEPKPLEKEIDFILQTFNQYFVYNPKKKDILSAFSGLRPLFVPPNLSYSPAKEISRSH
KLMISPSGLVTIIGGKWTTYRKMAEETVNKAIEIGKLNKVSSGTKNLKIFASRNSSSSCK
NYNNLGDKYGKVEFHIQKLIEENPLWGSPLISQSPYYCTKAEVIWMVRYEMARTIEDVLA
RRFRLLFLNAKIAIDIAPIVASLMAKELSLDEEWEESQIASFKELAMQYYYPVV
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaagggtttttaaatagagatagatttttaagaattttagaaaatataaatact
tgggatattgttattgttggaggaggagcaacagggttaggaatagcattagattccgct
tatagaggctataaaactcttcttttagaacaaaatgatttttctaaagggacttctagt
cgtagtactaaattaattcacggaggaatacgatatttagctcaaggaaatataaaatta
gtttatgaagctttgcaggaaaggggttttttattaaaaaatgctcctcatttggtgaaa
aaaaaacgatttgttattcctatttttagttggaaaacgggagttttttattggactggt
ttaaaaatttatgaatggttatctggatccttgagttttggaaattcccaatttttatct
aaaaatgaaatactaaaaatgtttcctgaaattagaccaaataatttaaaaggaggtatt
ttatattatgatggacaatttgatgatgctcgtttagctattgatttagcacaaacttgt
gttcaacaaggaggagtattactaaattattttaaagtgaaaaatcttattaaaaaaata
gaaaataaaatatctggtgtaatagcttatgatcttgaaactaaaaaaaaatattctatt
tattcaaaagtagttattaatgccactggagtcttttccgattctattttaaaaatggat
gattctacatgtcctatattgataaagcctagtcaaggaacgcatattgtattaaaaaaa
tctttttttagcagttcagatgctatagtaattccaaaaacttcggatggaagaattcta
tttagcataccatggtatgatcatgttttagtaggaactacagatacttttttggacaaa
agtattcttgaacccaaacctttagaaaaagagatagattttattttacaaacttttaac
caatattttgtatataatccgaaaaaaaaagacattttaagtgctttttctggtttacgt
cctcttttcgttcctcctaatttatcttattctcctgctaaagagatttctagatctcat
aaattgatgattagtccttctggcctagtaactattataggaggaaaatggactacatat
agaaaaatggcggaagaaactgtcaataaagctattgaaataggaaaattaaataaagtt
tcttctggaaccaaaaatcttaagatttttgcttccagaaattcttcttcttcatgcaag
aattataataatttgggggataaatatggaaaagtagaatttcatattcaaaaattaatt
gaggaaaatcctttatggggaagtccattaatttcccaatctccttattattgtacaaaa
gcagaagtgatatggatggtacgttatgaaatggctagaaccattgaagatgttttagca
agaagatttcgtttattatttttaaatgctaaaatagcaatagatatagcaccaatagta
gcatcattaatggctaaagaactttctctagatgaagaatgggaagaatcacagatagct
tctttcaaagagttagccatgcaatattattatccagtagtttga

DBGET integrated database retrieval system