KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00285Help
Entry
BLi00285          CDS       T00200                                 

Gene name
ycbD
Definition
(GenBank) aldehyde dehydrogenase YcbD
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BLi00285 (ycbD)
Enzymes [BR:bld01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BLi00285 (ycbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OprB
Motif
Other DBs
NCBI-ProteinID: AAU39244
LinkDB All DBs
Position
259219..260685
Genome map
AA seq 488 aa AA seqDB search
MSVAAESKTYFNFINGRWVKAESGGMEQSLNPADTRDIVGLVQKSSIEDVDRAVEAAKQA
KKAWRKLSGAERGQFLYKAADIMEQRLDEIAECATREMGKTLPEAKGETARGIAILRYYA
GEGLRKTGDVIPSTDSSAFMYTDRVPLGVVGVISPWNFPVAIPIWKMAPALIYGNTVVIK
PATETAVTCLKVISCFEEAGIPSGVVNAVTGPGSSAGQRLAEHPDVNGITFTGSNQTGKI
IGRTAFERGAKYQLEMGGKNPVIVADDADLDIAVEAVISGAFRSTGQKCTATSRVIVLNG
VYDRFKEKLLQQTKEITIGDSLKEDVWMGPIANKQQLDNCLSYIAKGKQEGADLIFGGER
LADGKYENGYYIRPAIFDNVTSGMTIAQEEIFGPVIALIKADTLEEALETANDVKFGLSA
SIFTQNIRRMLSFTDEIEAGLIRVNAESAGVELQAPFGGVKQSSSHSREQGEAAKEFFTA
VKTVFVKP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgcagctgaaagtaaaacgtatttcaactttatcaacggccgctgggtgaag
gctgaatcgggcgggatggaacagagcttgaatccggcagatacacgggatatcgtcggg
cttgtgcaaaaatcttcgattgaggatgtagaccgggcagttgaagcggccaagcaggcc
aaaaaggcgtggagaaagctgtcgggcgcggagcgcggtcaattcctttacaaggccgct
gacatcatggaacagcgcctcgatgaaattgccgaatgtgcgacgcgtgaaatgggcaaa
acactgcctgaagcaaaaggcgaaacagcgcggggaatcgcgattctcagatactatgcc
ggagaggggctgcggaaaacaggtgatgtgattccgtcgaccgattcatccgcttttatg
tacacagacagggtgccgctcggcgtcgtcggcgtcatctcaccgtggaatttccctgtt
gccatcccgatttggaaaatggcgcctgctcttatttatggaaatacggttgtcattaag
ccggctacggaaaccgcagtcacctgccttaaggttatatcgtgctttgaagaagcaggg
attccctcaggcgtggtcaatgcggtgacaggaccgggatcatcggccggccaaaggctt
gccgagcacccggatgtgaacggaattacgttcacaggatcgaatcaaacaggaaaaatc
atcggccggacggcgtttgaaagaggggcgaagtaccagcttgagatgggcggcaaaaac
ccggtgatcgtagcggatgacgccgaccttgatattgcggttgaagcggtcatcagcgga
gcgttcaggtcgacaggccaaaagtgtacagcgacaagccgcgtcatcgtcttaaatggt
gtttatgaccgttttaaagaaaagctgcttcaacagacaaaagagattacaatcggcgac
agcttaaaagaagatgtctggatggggccgattgcgaacaaacagcagcttgacaactgc
ctgtcctatattgcaaaaggaaagcaagaaggcgcggacctcattttcggcggtgagagg
ctggcagatggaaaatacgaaaacggctattatatcaggccggccatttttgacaacgtc
acttccggcatgacgattgcccaagaagaaattttcggcccggtcatcgctttaatcaag
gcggatacacttgaggaagcgttggagacggcaaatgacgtcaaatttggcctgagcgcc
tccatttttacgcaaaacattaggcggatgctgtcattcacagatgaaatcgaagcgggg
ctcattcgcgtcaacgccgaaagcgccggtgtcgaactgcaggcgccattcggaggcgtt
aaacaatcgagctcgcattcacgggaacagggggaggcagccaaagaattttttacagcc
gtgaaaaccgtatttgtcaaaccgtaa

DBGET integrated database retrieval system