KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00543Help
Entry
BLi00543          CDS       T00200                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase Ddl
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00473  D-Alanine metabolism
bld00550  Peptidoglycan biosynthesis
bld01100  Metabolic pathways
bld01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BLi00543 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLi00543 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BLi00543 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bld01011]
    BLi00543 (ddl)
Enzymes [BR:bld01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BLi00543 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bld01011]
 Precursor biosynthesis
  Amino acid ligase
   BLi00543 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AAU39499
UniProt: Q65N65
LinkDB All DBs
Position
548537..549622
Genome map
AA seq 361 aa AA seqDB search
MKTRLGLVYGGKSAEHNVSLQTALAVTKALDTEKFDIHPIYITEKGEWVRGPQLTEPVSN
VKMLQFEQTGQTFSPAVLNRDMFPGEADAKEDSIDVVFPLLHGPNGEDGTIQGMLELLNV
PYVGNGVLASSAGMDKVVMKHLFAQAGLDQAKYVSFLKKTWSQSKEECYAQVEGELGYPC
FVKPANLGSSVGISKCRSREELDQAFELAFQYDRKIVVEEGVIGREIELGVLGNDEPVCS
VAGEIAPKKDFYDYKAKYEDGDTDLIIPASLTEDEYETMRSMAVKAFQAIDGSGLVRADF
FLTNEGRVLINEVNTMPGFTPFSMFPLLWKQSGVEYAELIEKLVALAIERHEEKQQIKHT
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgaagacaagattaggattggtatacggcggaaaatcagcggagcataacgtttctctg
caaaccgcgctggccgtcacgaaagcattagatactgaaaaatttgatatacacccgatt
tatataacagaaaaaggcgagtgggtgagagggccgcaactgacagaaccggtttcaaat
gtgaaaatgctgcaatttgaacagacgggccagacattttctccggctgtgttgaaccgc
gatatgtttcctggcgaagctgatgcaaaagaagactctatcgatgttgttttcccgctt
ttgcacggaccgaatggggaagacggcaccattcaagggatgcttgaactattgaatgtg
ccatatgtgggcaacggagtcttggcttcctctgcgggcatggataaagtggtcatgaag
catctgtttgcacaggcaggtcttgaccaggcgaaatacgtttcatttttgaaaaaaact
tggagtcagtctaaagaagaatgctatgctcaagtggaaggggaacttggctatccgtgc
tttgtaaaaccggccaaccttggatcaagcgtcgggatcagcaaatgcagaagccgtgaa
gagcttgaccaagcctttgagcttgcattccaatatgaccggaaaattgtcgttgaagag
ggcgtcatcggacgggaaatagaactcggcgttttagggaatgatgaacctgtctgctca
gtcgcgggggaaatcgctccgaagaaagacttttatgactataaagcaaaatatgaagac
ggcgatactgatttgattattccggcttccctgacagaagacgaatacgaaacaatgcgc
agcatggcggtcaaagcgtttcaggcgattgacggttcaggccttgtgagagcggacttt
ttccttacaaatgaaggcagggtcctgatcaatgaagtcaatacgatgccgggattcacc
ccgttcagcatgtttccgcttctctggaagcaatcaggggttgagtacgctgaactgatt
gaaaagcttgtcgctttggcaatcgagcgccacgaagaaaaacagcagattaaacataca
ttttaa

DBGET integrated database retrieval system