KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi00551Help
Entry
BLi00551          CDS       T00200                                 

Gene name
alr1
Definition
(GenBank) alanine racemase Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00473  D-Alanine metabolism
bld01100  Metabolic pathways
bld01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BLi00551 (alr1)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BLi00551 (alr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bld01011]
    BLi00551 (alr1)
Enzymes [BR:bld01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BLi00551 (alr1)
Peptidoglycan biosynthesis and degradation proteins [BR:bld01011]
 Precursor biosynthesis
  Racemase
   BLi00551 (alr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AAU39507
LinkDB All DBs
Position
557904..559076
Genome map
AA seq 390 aa AA seqDB search
MMSLKPFYRKTWAEIDLTALKENVRNMKRHIGEHVRLMAVVKANAYGHGDAQVAKAALAE
GASILAVALLDEALSLRAQGIEEPILVLGAVPTEYASIAAEKRIIVTGYSVGWLKDVLGF
LNEAEAPLEYHLKIDTGMGRLGCKTEEEIKEMMEMTESNDKLNCTGVFTHFATADEKDTD
YFNMQLDRFKELISPLPLDRLMVHSSNSAAGLRFREQLFNAVRFGIGMYGLAPSTEIKDE
LPFRLREVFSLHTELTHVKKIKKGESVSYGATYTAQRDEWIGTVPVGYADGWLRRLAGTE
VLIDGKRQKIAGRICMDQFMISLAEEYPVGTKVTLIGKQKDEWISVDEIAQNLQTINYEI
TCMISSRVPRMFLENGSIMEIRNPILPDQS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcttaaaaccattctatagaaagacatgggccgaaatcgatttaacggcttta
aaagaaaacgtccgcaatatgaagcggcacatcggcgagcatgtccgcctgatggccgtc
gttaaagcgaatgcctacggacacggggatgcacaggtagcgaaggcggctcttgcagaa
ggggcgtccattcttgctgtggctttattggatgaagcgctttcgctgagggcgcagggg
attgaagaaccgattcttgtcctcggtgcagtgccgaccgaatatgcaagcattgccgcg
gaaaagcgcattatcgtgactggctactccgtcggctggctgaaagacgtgctcggtttt
ctgaatgaggccgaagctcctcttgaatatcatttgaagatcgacacgggcatgggccgc
cttggctgcaaaacggaagaagagatcaaagaaatgatggagatgaccgaatcgaacgat
aagctcaattgtacgggcgtgttcactcatttcgccacggcggacgaaaaggacaccgat
tatttcaacatgcagcttgaccgctttaaagagctgatcagccccctcccgcttgaccgt
ttgatggtgcattcgtcaaacagcgccgcgggtctgcgcttcagggaacagctatttaat
gccgtccgcttcggcatcggcatgtacggtttggcgccgtcaaccgaaataaaagacgag
ctgccgtttcgtctgcgggaagtgttttcgcttcataccgaactcacccatgtgaaaaaa
attaaaaaaggcgagagcgtcagctacggggcgacatatacagctcagcgcgacgaatgg
atcgggacagtccccgtcgggtatgccgacggatggctgaggcgcctggccggaacggaa
gtgctgatcgacggaaaacgccaaaaaatagcagggagaatctgcatggaccagttcatg
atttcccttgccgaagaataccctgtcggcacaaaggttaccttgatcggaaagcaaaaa
gacgaatggatctcagtcgacgaaatcgcccaaaatttgcagacgatcaattatgaaatt
acctgtatgataagttcaagggtgccccgtatgtttttggaaaatgggagtataatggaa
ataaggaatccgatcttgcctgatcaatcctga

DBGET integrated database retrieval system