KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01494Help
Entry
BLi01494          CDS       T00200                                 

Gene name
ykoU
Definition
(GenBank) ATP-dependent DNA ligase YkoU
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bld00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BLi01494 (ykoU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bld03400]
    BLi01494 (ykoU)
Enzymes [BR:bld01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BLi01494 (ykoU)
DNA repair and recombination proteins [BR:bld03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BLi01494 (ykoU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase mRNA_cap_enzyme DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AAU40395
LinkDB All DBs
Position
complement(1465910..1467760)
Genome map
AA seq 616 aa AA seqDB search
MGITMQPVLTTSAPSGGNWRYEVKYDGYRGLLKIAATGEVSLISRNSQPLENTFPEISEF
AKSMIETLKEHLPITIDGEIVSLTNRFRSRFEYVQKRGLSKKAELIAQAAAKKPCQYLAF
DLLVFNGESLTSLPYTERKRMLFDLMKELGLPMAPDPMAHARIQYIPDTSDFHDLWKAVK
RFDGEGIVAKKKDSRWAENKKTAEWLKLKNYKKAAVFMTGYNMANRYLTIAVYDRGQIKE
VGSVSHGLGEQERNAILSIVKQYGTETKPGEYTIDPSICMTVHYLTIHYGTLREVSFVSF
EFDMAWENCTYNRLLLHSRNVHPDLQLTSLDKVIFPKSDKTKADYIGYLNEIGDFLLPFL
DNRALTVIRYPHGSGGESFFQKNKPDYAPEFITSIRDDEHEHIICSDYSVLLWLANQLAL
EFHIPFQTVDTAHPTEIVFDLDPPSKSEFPLAVRAAKELHRLFDQLGLLSFPKLSGNKGI
QIYIPISKNAFTYEETRLFTSFAASYCVSLFPDLFTTERLIKNRGGKLYIDYVQHAPGKT
IICPYSTRGNELGTVAAPLFWDEVHSDLSPLNFTMEAVVKRTKELGCPFESFFRQPQDKQ
IKAILDHLKENNRSEN
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgggaattacgatgcagcctgtattgactacatcagctccctcaggcggcaattggcgg
tatgaagtcaaatatgacgggtatcggggtcttttaaagattgctgcgaccggcgaagtt
tcgctcatcagcagaaactcacagccgctcgaaaacacatttccggaaatttcggaattt
gcaaaaagcatgatcgaaactctcaaagaacacttgccgatcacgattgacggggaaatt
gtgtcgttgacaaaccgttttcgttcccgatttgaatatgtccaaaaaaggggtttgagc
aaaaaggccgagttgattgcacaagcagccgcaaagaaaccgtgccagtacttggctttt
gatttactggtttttaacggagaaagtttaacctcgctcccctataccgaacgaaaacgc
atgcttttcgacctgatgaaagagctcggcctgccgatggctcccgatccgatggctcac
gctcgaattcaatacatccctgacacttctgatttccacgacctttggaaggctgttaaa
aggtttgacggcgagggaattgtcgcgaagaaaaaagacagccgctgggctgaaaataaa
aaaacggccgaatggctcaaactcaaaaactacaaaaaagctgctgtatttatgacaggc
tacaacatggcaaaccgttatttgacaatcgccgtctatgaccgcggccaaatcaaggaa
gtcggttcggtttcccacggactcggagaacaggaaagaaacgccattctttcgatcgtc
aagcaatacggaaccgaaacaaaacccggtgaatataccattgatccgtcgatttgcatg
acggtccattacttaacgattcattacgggacattgcgcgaggtgtcgtttgtttcattt
gaatttgacatggcatgggaaaattgcacttacaaccgcctgctgcttcattcaagaaac
gtccatcccgatttgcagctgacaagccttgataaagtcatctttcctaaaagcgataaa
acaaaagcggattacatcggataccttaatgaaatcggcgattttctgcttccgtttctc
gacaatcgggcgcttaccgttatccgttatccgcacggttccggcggagagtcttttttt
caaaaaaacaagcccgactacgcacccgaatttatcacgtccattcgggatgacgagcac
gagcatatcatctgcagcgattattcggttctgctgtggcttgccaatcagcttgcgttg
gagttccatatcccttttcaaacggtggatacggcccatccgaccgaaatcgttttcgat
cttgatccgccttcaaagtcggagtttccgctggccgtcagagccgcgaaagagctgcac
cgtttatttgatcagctcggcctcttatcttttccaaagctgtcgggaaataaagggata
caaatctatattccgatttcaaaaaacgcctttacttatgaagaaacccgccttttcaca
agctttgcggcttcttattgcgtctcgctttttcccgatctgttcacaaccgaacgcctg
atcaaaaacaggggcggaaagctctatattgactatgtgcagcatgccccgggaaaaacg
atcatctgcccgtattccacaagaggcaatgagcttggcacagtggccgcaccgctgttt
tgggatgaagtccattcagacttgtcacccttaaattttacgatggaggctgtcgtcaaa
cgcacaaaggaactcggatgccctttcgaaagcttcttcagacagccccaggacaaacag
atcaaagctattctcgatcacttaaaagaaaacaaccgttcggaaaactga

DBGET integrated database retrieval system