KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02143Help
Entry
BLi02143          CDS       T00200                                 

Gene name
accC1
Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit AccC
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00061  Fatty acid biosynthesis
bld00620  Pyruvate metabolism
bld00640  Propanoate metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01120  Microbial metabolism in diverse environments
bld01130  Biosynthesis of antibiotics
bld01200  Carbon metabolism
bld01212  Fatty acid metabolism
Module
bld_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BLi02143 (accC1)
   00640 Propanoate metabolism
    BLi02143 (accC1)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BLi02143 (accC1)
Enzymes [BR:bld01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BLi02143 (accC1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BLi02143 (accC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_5 LAL_C2
Motif
Other DBs
NCBI-ProteinID: AAU41030
LinkDB All DBs
Position
complement(2091079..2092419)
Genome map
AA seq 446 aa AA seqDB search
MFKKVLIANRGEIALRIIRTCQRLGIQTAAVYSEADAESLHVKAADEAWLIGKPRVSESY
LNIEKIIETAKKAGVCAIHPGYGLLSENSRFAERCLKENITFIGPPPDVIAKMGSKIEAR
QAMEQAGVPVVPGVTKSLSGLNEARALAESIGYPVMLKASFGGGGIGMQLIRNESELEKA
YEGNQKRAADFFGDGAMYIEKYIEQARHIEIQILTDKYENAVYLWERDCSIQRRQQKIIE
EAPAPLFDETMRTKLGEAAVKAALSIGYVNAGTIEFLVDKENHFYFLEMNTRLQVEHPVT
EEITGLDLVEEQLNIAAGKPLSHKQKDIRRDGHAIEVRICAEDPKTFFPSPGRITDLKLP
EQPNVRHECAAAPGMTITPYYDPMIAKMIVKGSSREEAICTLAEALSQYQVKGIKTNIPL
LEDIVSSDEFRKGGVQTDFISRYQSK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaagaaagtactgattgccaaccggggagaaatcgccctccggatcatccgaact
tgtcaacggctcggtattcagacggctgctgtctactctgaagcggatgcggagtccctg
catgtcaaagctgcggatgaagcctggctgatcggcaaaccgcgggtcagtgaaagctat
ttaaatattgaaaaaatcatcgaaaccgctaaaaaagcgggggtctgtgccattcatccg
ggatacggcctgctttccgagaacagccgttttgccgaaaggtgcctcaaggagaatatt
acgtttatcggtccgccgcctgacgttatcgccaaaatgggaagcaaaattgaagcaaga
caagcgatggaacaagccggggttcccgtcgttcccggcgtgacaaaaagcttgtccggt
ctgaatgaagcccgggctcttgccgaatccatcggctatcccgtgatgctcaaggcttct
tttgggggcggcggcatcggaatgcagctgatccgcaatgaaagcgaattagaaaaagca
tatgaaggcaaccaaaaacgagccgccgattttttcggagacggggctatgtacatcgag
aaatatatcgaacaggcaagacatatcgagattcagattttaacagacaaatacgaaaat
gccgtctatctttgggagcgggactgttcgattcagagacgccagcaaaaaatcatcgaa
gaagcacctgctccgttattcgatgaaaccatgcgcacaaagctcggtgaagcggccgtg
aaagctgcgctgtcgatcggctatgtcaacgccgggacaatcgagtttttagtagacaag
gagaatcatttttattttcttgagatgaatacccgcctgcaagtcgaacacccggtgaca
gaggaaattacagggcttgaccttgtcgaagaacagctcaatatcgcagcgggaaaaccg
ctttcccataagcagaaagacattcggcgggacggacatgcgatcgaagtcagaatctgt
gccgaagatccgaaaacatttttcccttcgccggggcggattaccgaccttaagctgcct
gagcaaccgaatgtccgtcatgaatgcgcagcagccccgggtatgactatcaccccgtat
tacgacccgatgattgccaagatgatcgtcaaaggaagcagcagagaagaagccatctgc
acattggccgaagcgctttcacaatatcaagtgaaaggcattaaaacgaacattccgctc
cttgaagacattgtaagttctgacgaattccgaaaaggcggggtccaaaccgattttatc
agtcgctatcagtcaaaatga

DBGET integrated database retrieval system