KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02372Help
Entry
BLi02372          CDS       T00200                                 

Gene name
aspB
Definition
(GenBank) L-aspartate aminotransferase apoenzyme AspB
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00220  Arginine biosynthesis
bld00250  Alanine, aspartate and glutamate metabolism
bld00270  Cysteine and methionine metabolism
bld00330  Arginine and proline metabolism
bld00350  Tyrosine metabolism
bld00360  Phenylalanine metabolism
bld00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bld00401  Novobiocin biosynthesis
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01130  Biosynthesis of antibiotics
bld01210  2-Oxocarboxylic acid metabolism
bld01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BLi02372 (aspB)
   00270 Cysteine and methionine metabolism
    BLi02372 (aspB)
   00220 Arginine biosynthesis
    BLi02372 (aspB)
   00330 Arginine and proline metabolism
    BLi02372 (aspB)
   00350 Tyrosine metabolism
    BLi02372 (aspB)
   00360 Phenylalanine metabolism
    BLi02372 (aspB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLi02372 (aspB)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    BLi02372 (aspB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bld01007]
    BLi02372 (aspB)
Enzymes [BR:bld01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     BLi02372 (aspB)
Amino acid related enzymes [BR:bld01007]
 Aminotransferase (transaminase)
  Class I
   BLi02372 (aspB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AAU41252
LinkDB All DBs
Position
complement(2318239..2319423)
Genome map
AA seq 394 aa AA seqDB search
MNLAKRVSALTPSATLAITAKAKELKAAGHDVIGLGAGEPDFNTPEHIIEAAVRSMNEGH
TKYTPSGGLAALKDSIRDKFKRDQGIEYSQSEVIVCTGAKHALYTLFQVLLDEGDEVIIP
TPYWVSYPEQVKLAGGKPVFVEGLEENSFKISPEQLEKAVTEKTKAVIINSPSNPTGMMY
TEEELKALGEVCLRRNVLIVSDEIYEKLIYGGKKHVSIAQLSPELKNQTVIINGVSKSHS
MTGWRIGYAAGSEPIIKAMTNLASHSTSNPTSVAQYGAIAAYNGPNEPVEEMRKAFEERL
NKVYELLVDIPGLTCLKPEGAFYLFPNAKKAAESCGFSSVDEFAEALLEEEKVAIVPGSG
FGAPDNIRLSYATSLSLLEEAVERIRRFVVNRSR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
ttgaatctagctaaaagagtatcagcgttaacaccatctgcaacattggcaatcactgca
aaagcaaaagaattaaaagcggcagggcacgacgtcatcggtcttggggcaggtgagccg
gattttaatacgcctgagcacatcattgaagcggctgtccgttcgatgaacgaaggacat
accaaatacacgccttccggcggtcttgcggcgctgaaagacagcatccgcgataaattc
aagcgcgatcagggaattgaatacagccaatcggaagttattgtgtgcacaggtgcaaag
catgctctttacaccctatttcaagtgctcctcgacgaaggggacgaagtgattattccg
actccgtactgggtcagctatcctgaacaagtcaagcttgcaggcggcaaacctgtgttt
gtggaaggccttgaggaaaacagcttcaagatttctccggagcagctcgaaaaagccgtc
acagaaaaaacgaaggctgtgatcatcaattccccaagcaatccgacagggatgatgtat
acggaagaagagctcaaagctctcggtgaagtatgccttcgacgcaacgttttaatcgta
tctgatgaaatatatgaaaagctgatttacggcggaaaaaaacatgtatccattgcacag
ctttctccagaacttaaaaaccaaaccgtgatcatcaacggggtttccaagtcacacagc
atgaccggctggagaatcggttatgcagcaggcagcgaaccgatcattaaagcgatgacg
aacctagccagccacagcacgtcaaatccgacatctgtcgctcaatatggagccattgcc
gcttacaatgggccaaacgagcctgttgaggagatgagaaaagcttttgaagaacggctg
aacaaggtgtatgaactgcttgttgacattccgggattaacatgcctgaagcctgaagga
gccttctacttgttcccgaatgcaaaaaaagcggcagaatcgtgcggcttttcaagcgtt
gatgaattcgccgaagcgcttttggaagaagaaaaggttgcgatcgttcctggttcaggg
ttcggcgcaccggacaacatccgtctgtcgtatgcgacatccctgtcacttttggaagaa
gcggttgaacgcatccgccgctttgtcgtgaatcgcagccgctag

DBGET integrated database retrieval system