KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02828
Entry
BLi02828          CDS       T00200                                 

Gene name
levG
Definition
(GenBank) fructose-specific phosphotransferase system EIID component LevG
  KO
K02771  fructose PTS system EIID component
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00051  Fructose and mannose metabolism
bld02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BLi02828 (levG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BLi02828 (levG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bld02000]
    BLi02828 (levG)
Transporters [BR:bld02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BLi02828 (levG)
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AAU41698
LinkDB
Position
complement(2714796..2715623)
AA seq 275 aa
MGTEKRLTKREIFSMFIRSNFLLGSFNFERVQALGYCYVMIPAIKKLYGPGAKRSEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANNKKIDAKAINGMKIGLMGPLAGVGDPIFWGTL
RPVLAALGASLALSGNIAGPLLFFFLINAVRLSTKYYGLKYGYVKGMEILQDLVGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDDAGKVDVQTVQNILDSIMPGVLPLGL
TLLAAWMLRKGVNPLLMIFGIFIIGIVGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atgggcacagaaaaaagattaacgaagagagagattttcagtatgtttatccgctcaaac
tttttgctcggatcttttaactttgagcgtgtacaggcgctcggctactgctacgtcatg
attccggcgatcaaaaaactgtacggtccgggagcaaaacggagcgaagcgctccagcgc
catttggaatggtttaatacacatccgtggctgacagcgccgatatttggcgtaaccgct
gcgatggaagaagaaatggccaacaataaaaagattgatgccaaagcaattaatggaatg
aaaatcggcttaatgggcccgttggcaggcgtgggcgacccgattttctgggggacgttg
cgcccggttttggcggccttgggagcgtcgcttgctttaagcggaaacatcgccggcccg
cttttgtttttctttttaatcaacgccgtcagattaagcactaaatactacggattaaag
tacggctatgtgaaaggcatggaaatattgcaggacttggtggggaaccgcattcaaaaa
ctgacggaaggcgcttcaatactcgggctgtttgtgatgggagctctcgtttccaagtgg
accacaatcaatatcccgatcgtcgtgtcgagaattaaggatgatgcaggcaaagtcgat
gtacagaccgtgcaaaacattttagacagcatcatgcctggtgtgctgcctttaggattg
acattgctcgctgcctggatgcttcgcaaaggggtgaatcctctgctcatgattttcggt
atttttatcatcgggattgtcggctattgggcaggttttttggcataa

DBGET integrated database retrieval system