KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02831
Entry
BLi02831          CDS       T00200                                 

Gene name
levD
Definition
(GenBank) fructose-specific phosphotransferase system EIIA component LevD
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00051  Fructose and mannose metabolism
bld02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BLi02831 (levD)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BLi02831 (levD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bld02000]
    BLi02831 (levD)
Enzymes [BR:bld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BLi02831 (levD)
Transporters [BR:bld02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BLi02831 (levD)
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: AAU41701
LinkDB
Position
complement(2716957..2717394)
AA seq 145 aa
MITVIISGHGNFPIALKESSGMIFGEEESLIAVPFLKGEGIQTLQEKYHQTLKDVPEEHE
VLFLVDIFGGTPYNAATPYIAKERRFDMAAGVNLPILLEALSLREHMPLKQLLNQLKKMS
RECFQICSEQLEKFSQSNQGREDEL
NT seq 438 nt   +upstreamnt  +downstreamnt
atgattacagtcattatcagcggccacggaaactttcccatagcattaaaagaatcttca
gggatgatattcggagaagaggagagcctgatcgcggtgccgtttctgaaaggggaaggc
attcagacactgcaagaaaaatatcatcagacgctgaaggatgttccggaggaacacgag
gtgctttttttagtggatattttcggcgggacgccatataacgcagcgaccccttacatc
gcgaaagagcggagattcgatatggcagccggagtgaacctgccgattttgttagaggca
ttgagcttgagggagcatatgccgctcaaacaactgctgaaccagttgaaaaagatgagc
cgggaatgcttccaaatatgcagcgagcaattggaaaaattcagtcagtccaatcaggga
agagaggatgaattgtaa

DBGET integrated database retrieval system