KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02883Help
Entry
BLi02883          CDS       T00200                                 

Gene name
yrzK
Definition
(GenBank) YrzK
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YrzK
Motif
Other DBs
NCBI-ProteinID: AAU41752
LinkDB All DBs
Position
complement(2773640..2773786)
Genome map
AA seq 48 aa AA seqDB search
MGRAIHEQDANLHLKEHADPERAGFMEETATELGLTSKESIQNKKNRK
NT seq 147 nt NT seq  +upstreamnt  +downstreamnt
atgggcagggcgatccatgagcaagatgcgaatctgcatctaaaggagcatgcggacccg
gagcgcgccggcttcatggaagaaacggccactgagctggggctgacgtccaaagaatca
attcagaataaaaagaaccgcaaatag

DBGET integrated database retrieval system