KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02898Help
Entry
BLi02898          CDS       T00200                                 

Gene name
queA
Definition
(GenBank) S-adenosylmethionine tRNA ribosyltransferase QueA
  KO
K07568  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Brite
KEGG Orthology (KO) [BR:bld00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bld03016]
    BLi02898 (queA)
Enzymes [BR:bld01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.17  S-adenosylmethionine:tRNA ribosyltransferase-isomerase
     BLi02898 (queA)
Transfer RNA biogenesis [BR:bld03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BLi02898 (queA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Queuosine_synth
Motif
Other DBs
NCBI-ProteinID: AAU41766
UniProt: Q65GP8
LinkDB All DBs
Position
complement(2788880..2789908)
Genome map
AA seq 342 aa AA seqDB search
MKVELFDFDLPERLIAQVPLKERDASRLMVLDKKTGEITHSTFKHVIDFLNAGDCIVLND
TRVLPARLYGVKEETGAKVEVLLLKQEEGDVWETLVKPAKRVKRGTVLSFGDGRLTAVCT
EELEHGGRKIEFRYEGIFYEVLESLGEMPLPPYIKEQLDDRERYQTVYSKKQGSAAAPTA
GLHFTEEILDALREKGVHIAFITLHVGLGTFRPVSAENVEEHDMHAEFYEMSEETAALLN
RVRQEGGRIISVGTTSTRTLETIASEHDGRFREASGWTSIFIYPGYTFRAIDGMITNFHL
PKSSLIMLVSALAGREHVLSAYRTAVEHEYRFFSFGDAMLIK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaattattcgattttgacttgcctgaacgcctcatcgcacaggttccttta
aaagagcgggatgcgtccaggctgatggtgctggataaaaaaacaggggagatcactcac
agcacgtttaagcacgtgattgattttctgaacgcgggcgattgcatcgttctgaacgat
acgagggtgctgccggcccgcttgtacggagtcaaggaagagacgggagcaaaggttgaa
gttcttctgttaaaacaggaggaaggggacgtctgggaaacgcttgtcaagcccgcaaag
cgggtcaagcgcggaactgttctttcgttcggtgacggccgtctaacggcggtctgcaca
gaagagctcgagcacggcggcagaaaaattgaattccgctatgaagggattttttacgag
gtgctcgagtcgctcggtgaaatgcctctgcctccttatattaaagaacagctcgatgac
agggagcgctatcagacggtttactcaaagaaacaaggatcggcggctgcgccgacggcc
gggctgcattttacggaagagattctcgatgcgctcagggaaaaaggcgtgcatattgcg
tttatcacccttcatgtcggtcttgggacattccggcctgtcagtgcggaaaatgtagag
gaacacgacatgcatgccgagttttatgaaatgtcggaagaaacggcagcattgttaaac
cgcgtcagacaggaaggcggaaggatcatttccgtcggcacgacatcgacgagaacgctt
gagacaatcgcttccgagcatgacggccgcttccgggaagcgagcggctggacatcgatt
tttatctatcccggctacacattccgggcaatagacgggatgattaccaattttcatctt
ccgaaatcgtccctcattatgcttgtcagcgcgctcgcaggcagagagcatgtgctttcc
gcctaccggaccgcagtggaacacgaataccgcttcttcagctttggagacgccatgttg
atcaaataa

DBGET integrated database retrieval system