KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02992Help
Entry
BLi02992          CDS       T00200                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit SdhB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00020  Citrate cycle (TCA cycle)
bld00190  Oxidative phosphorylation
bld00650  Butanoate metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01120  Microbial metabolism in diverse environments
bld01130  Biosynthesis of antibiotics
bld01200  Carbon metabolism
Module
bld_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bld_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLi02992 (sdhB)
   00650 Butanoate metabolism
    BLi02992 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BLi02992 (sdhB)
Enzymes [BR:bld01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BLi02992 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BLi02992 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_18 Fer4_16 Fer4_2 Fer4 Fer4_4 Fer4_13 Fer4_21 Fer4_3 Fer4_15
Motif
Other DBs
NCBI-ProteinID: AAU41859
LinkDB All DBs
Position
complement(2872716..2873480)
Genome map
AA seq 254 aa AA seqDB search
MSENKTIKFIITRQDTSDSNPYQEEFEIPYRPNMNVISALMEIRRNPVNAKGEKTSPIAW
DMNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLEPMKTFPVVRDLQVDRSRMFDSL
KKVKAWVPIDGTYDLGPGPRMPERRRQWAYELSKCMTCGVCLEACPNVNDKTNFMGPAPL
SQVRLFNTHPTGAMNKSERLEAIMGDGGLAECGNSQNCVQSCPKGIPLTTSIAALNRDTT
VQAFKNFFGSDNTE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaataagacaatcaagtttatcatcactcgtcaggatacatcggattctaat
ccttaccaggaagagtttgaaattccataccgtccgaatatgaacgtgatttccgctttg
atggaaatcagaaggaacccggtgaatgcaaagggagaaaaaacgtcgccgattgcttgg
gatatgaactgtctcgaggaagtgtgcggcgcttgctccatggtgatcaacggcaagccg
agacagtcctgtacagcgctgatcgaccagcttgagcagccgatccgccttgaaccgatg
aaaacattcccggttgtccgcgaccttcaagtggatcggagccgcatgtttgattcgtta
aagaaagtcaaagcatgggtgccgatcgacggcacatatgatctcggaccgggaccgaga
atgcctgaaagaagacgtcagtgggcttatgagctgtcaaaatgcatgacttgcggcgtg
tgtcttgaagcttgtccgaacgtgaacgataaaacaaactttatgggacctgcaccgctc
tcgcaagttcgcttattcaacacccatccgacgggagcgatgaacaaatctgaacggctt
gaagcgattatgggagacggcggactggccgaatgcggcaactcgcaaaactgcgtgcag
tcgtgtccgaaaggcatcccgctcacaacctcaatcgctgcattaaacagggatacgacc
gttcaggcgtttaaaaacttcttcggaagcgacaacacggaataa

DBGET integrated database retrieval system