KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi02993Help
Entry
BLi02993          CDS       T00200                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit SdhA
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00020  Citrate cycle (TCA cycle)
bld00190  Oxidative phosphorylation
bld00650  Butanoate metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01120  Microbial metabolism in diverse environments
bld01130  Biosynthesis of antibiotics
bld01200  Carbon metabolism
Module
bld_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bld_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLi02993 (sdhA)
   00650 Butanoate metabolism
    BLi02993 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BLi02993 (sdhA)
Enzymes [BR:bld01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BLi02993 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BLi02993 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored DAO NAD_binding_8 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AAU41860
LinkDB All DBs
Position
complement(2873477..2875240)
Genome map
AA seq 587 aa AA seqDB search
MSNSSIIVVGGGLAGLMATIKAAEAGTNVKLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPSIIHLLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAYAGATTGQQLLYALDEQVRRFEVEGLVSKYEGWEFLGAVLDDDNTCRGIVAQNLT
TMEIESFRSDAVIMATGGPGIIFGKSTNSMINTGSAASIVYQQGAYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVRQK
LGINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFMGDDPRKLPMKIFPAVHYSMGGLWV
DYDQMTNIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPKAVEYIQGLETSAEDL
SSSVFDAYVKKEEEKWADIMKMDGNENAYVLHKELGEWMTDNVTVVRYNDKLLKTDEKIQ
ELAERYRNININDTAKWSNQGAVFTRQLHNMLQLARVITLGAYNRNESRGAHYKPDFPER
NDEEWLKTTMAKHAGDFEAPKFHYEDVDVSLIAPRKRDYSKKKVAKS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattcaagcatcatcgttgtcggcggaggactagcgggtctgatggcgaccatt
aaagctgcggaagcaggaacaaatgtaaaactattttcgatcgttcccgttaagcgctca
cattccgtatgtgcgcagggcggaatcaacggagcggtcaatacaaaaggtgaaggagac
tccccatgggagcattttgacgacacggtgtacggaggcgactttctggcgaaccagccg
ccggtcaaagcgatgtgtgaagcggcgccgtcgatcattcatttgcttgaccgcatgggc
gtcatgtttaacagaacgcctgaagggctgcttgacttccggcgcttcggaggaacccag
catcacagaacggcatatgcgggggcgacgaccggacagcagctcttgtacgcgctggat
gagcaggttcgccgcttcgaagttgaagggctcgtttcgaaatatgaaggctgggagttt
ctcggagccgttcttgatgatgacaatacgtgcaggggcatcgtcgcccaaaacttaacg
acgatggaaatcgagtcgttccgttcggacgcagtcatcatggcgaccggggggccgggc
atcatcttcggaaaatcgacgaactcgatgatcaataccggatcagccgcttcgatcgtt
taccagcagggtgcttactatgcgaacggagagttcatccagatccatccgaccgccatt
cctggagacgacaagctgcggctgatgagcgaatcggcgcgcggtgaaggcggacgagtc
tggacgtataaagacggcaagccttggtatttcctcgaagagaaatatccggcatatgga
aaccttgtgccgcgtgatattgcgacgcgtgaaatatttgatgtgtgcgtcagacaaaag
ctcggcatcaacggcgaaaacatggtttatctcgatctttcccacaaagatccgaaggaa
ttggacatcaagctgggcggaatcattgaaatctatgaaaaattcatgggtgacgatccg
cgcaagctgccgatgaaaatcttccctgcggttcactactcaatgggcggactttgggtc
gactacgatcagatgaccaacattcctggactgtttgccgcgggagaatgcgactattcg
atgcacggcggaaaccgcctgggagcgaactcgctcttgtcagccatttacggcggcatg
gtggcaggtccgaaagccgttgaatacattcaaggtctcgaaacatccgcagaagatctg
tcttcttccgttttcgatgcatacgtcaaaaaggaagaagaaaagtgggctgacataatg
aaaatggacggcaatgaaaatgcttatgtccttcataaagagctcggcgaatggatgaca
gacaacgtgacggtcgtgcgctacaatgacaagctgctgaaaacggatgaaaaaatccaa
gagcttgccgagcgctaccgaaacatcaatatcaacgatacggcaaaatggagcaaccag
ggcgccgtattcacgcgccagctgcacaacatgctgcaattggcacgggtgatcacgctc
ggtgcatacaaccggaatgagagccgcggcgcccattataaaccggatttccctgaacgt
aatgacgaggaatggctgaaaacaacaatggcgaaacatgcaggcgattttgaagccccg
aaattccattatgaggatgtcgatgtttcattaatcgcaccgcgtaaacgggattactcg
aagaaaaaggtggcgaaatcatga

DBGET integrated database retrieval system