KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03061Help
Entry
BLi03061          CDS       T00200                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase Icd
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00020  Citrate cycle (TCA cycle)
bld00480  Glutathione metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01120  Microbial metabolism in diverse environments
bld01130  Biosynthesis of antibiotics
bld01200  Carbon metabolism
bld01210  2-Oxocarboxylic acid metabolism
bld01230  Biosynthesis of amino acids
Module
bld_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bld_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLi03061 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BLi03061 (icd)
Enzymes [BR:bld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BLi03061 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AAU41926
LinkDB All DBs
Position
complement(2947007..2948323)
Genome map
AA seq 438 aa AA seqDB search
MFFYIEELHIMGGFIVAQGEKITVSGGVLNVPNNPVIPFIEGDGTGPDIWRAASRVLEAA
VEKAYNGEKKITWKEVYAGEKAYNKTGEWLPEETLDTIREYLIAIKGPLTTPVGGGIRSL
NVALRQELDLFTCLRPVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQK
LISFLKNELGVNKIRFPETSGIGIKPVSEEGTSRLVRAAIEYAIEHGRKSVTLVHKGNIM
KFTEGAFKNWGYEVAEKEFGDKVFTWAEYDRIAEKDGKDAANKAQSEAEAAGKIIIKDSI
ADIFLQQILTRPAEFDVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATH
GTAPKYAGLDKVNPSSVILSGVLLLEHLGWNEAADLVIKSMEKTIASKVVTYDFARLMDG
ATEVKCSEFGDELIKNMS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtttttctatattgaagaattacatattatgggaggttttattgtggcacaaggcgaa
aaaattacagtctccggcggagtattaaacgttccaaacaacccggtcatcccgtttatt
gaaggggacggaacaggtcctgatatttggagagcggcttccagggttcttgaagcggct
gtggagaaagcgtataacggcgaaaagaaaatcacttggaaagaagtctacgccggggaa
aaagcgtacaacaaaaccggcgaatggcttccggaagaaacgcttgatacgatccgcgaa
tacctgatcgcgattaaaggtcctttaacaactcctgtaggcgggggaatccgctcatta
aacgtagcgctcagacaagagcttgacttgtttacatgcctgcgtcctgtccgctatttc
acaggcgttccttcaccggttaagcgccctgaagatacggacatggtcatcttccgtgag
aatactgaagatatctacgccggcatcgagtacgcgaaaggctctgaagaagtgcaaaag
ctgatttcattcctgaaaaacgagcttggcgttaacaaaatccgcttccctgaaacatcg
ggcatcggcatcaagccggtttctgaagaaggaacatcaaggcttgtcagagctgcgatc
gagtatgcgatcgagcacggccgcaaatctgtgacgctcgtccataaaggaaacatcatg
aaattcacggaaggcgcctttaaaaactggggctatgaagtggctgaaaaagaattcggc
gataaagtattcacttgggccgaatacgaccgcatcgctgaaaaagacggcaaagacgct
gcaaacaaagcgcaaagcgaagctgaagctgccggcaaaatcatcatcaaagacagcatc
gccgacatcttcctgcagcagattctgacacgtcctgccgagtttgacgttgtggcgaca
atgaacctgaacggggactacatttcagatgcgctggctgcccaagtcggcggaatcggc
atcgcacctggagcaaacatcaactatgagacaggacatgccatctttgaggcgacacat
ggtacagcgcctaaatacgccggcctcgacaaagtaaacccgtcttcagtcatcctatcc
ggcgtgctgcttcttgagcatttgggctggaatgaggcggccgaccttgtcattaaatca
atggagaaaacaatcgcatccaaagtcgtcacatacgatttcgctcgtttgatggacggc
gcgactgaagtcaaatgctctgaattcggtgatgagcttatcaaaaacatgtcttaa

DBGET integrated database retrieval system