KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi03068Help
Entry
BLi03068          CDS       T00200                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Pathway
bld00010  Glycolysis / Gluconeogenesis
bld00030  Pentose phosphate pathway
bld00051  Fructose and mannose metabolism
bld00052  Galactose metabolism
bld00680  Methane metabolism
bld01100  Metabolic pathways
bld01110  Biosynthesis of secondary metabolites
bld01120  Microbial metabolism in diverse environments
bld01130  Biosynthesis of antibiotics
bld01200  Carbon metabolism
bld01230  Biosynthesis of amino acids
bld03018  RNA degradation
Module
bld_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bld_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLi03068 (pfkA)
   00030 Pentose phosphate pathway
    BLi03068 (pfkA)
   00051 Fructose and mannose metabolism
    BLi03068 (pfkA)
   00052 Galactose metabolism
    BLi03068 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    BLi03068 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BLi03068 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bld01009]
    BLi03068 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bld03019]
    BLi03068 (pfkA)
Enzymes [BR:bld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BLi03068 (pfkA)
Protein phosphatases and associated proteins [BR:bld01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BLi03068 (pfkA)
Messenger RNA biogenesis [BR:bld03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BLi03068 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AAU41932
UniProt: Q65G82
LinkDB All DBs
Position
complement(2954190..2955149)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLEIGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIANLKKYGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDLTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAESILIPEADYDMEEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEATNL
ETRVSVLGHIQRGGSPTAADRVLASRLGAFAVELLLEGKGGRCVGIQNNQLVHHDIIEIL
EQKHTIDQSMYRLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtatcggagtattgacaagcggcggagattccccgggaatgaacgcggcggtc
cgcgcggttgtcaggaaagcgatctaccatgacgtagaagtatacggaatttacaacggg
tattcaggtttaatcagcggaaaaatagaaaagcttgaaatcggttctgtcggagatatc
attcaccgcggaggaacgaagctatatacagcaaggtgtcctgagtttaaaacggtagaa
ggacgggaaaaaggaatagcgaatttaaaaaaatatggtatagaaggattagtcgtcatt
ggcggcgacggttcttatatgggagccaaaaagctcacagaacacggttttccttgtgtg
ggagtgccgggaacgatcgacaatgacatcccaggcactgatctgacgatcggattcgat
acggcgctaaataccgttattgacgccatcgataaaatcagggatacagctacatcccat
gaacgtacatacgtgattgaagtaatgggccgccatgccggggacattgctttatggtca
ggtttggccggaggcgcggaatccattttgattcctgaagcagactacgatatggaagaa
attattgcaaggctgaaaagagggcatgagcgcggcaagaaacacagcatcatcattgtg
gcggaaggcgtcggcagcggcgttgaattcggaaaaagaattgaagaagccacaaatctc
gaaactagagtatcggtgcttggacatatccagcgcggcggttccccgactgcagcagac
cgcgtattggcaagccgtctaggggcatttgcggttgaactgcttcttgaaggaaaaggc
ggacgttgtgtaggaattcaaaataaccagcttgtgcatcatgatatcattgaaatactc
gagcaaaaacatacaattgatcaaagcatgtaccgcttgtctcaagaactgtcaatctag

DBGET integrated database retrieval system