KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi04292Help
Entry
BLi04292          CDS       T00200                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase large subunit/NADH dehydrogenase AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Brite
KEGG Orthology (KO) [BR:bld00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BLi04292 (ahpF)
Enzymes [BR:bld01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BLi04292 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 FAD_oxidored GIDA HI0933_like AlaDh_PNT_C DAO Thi4 NAD_binding_7 FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin FANCI_S3
Motif
Other DBs
NCBI-ProteinID: AAU43105
LinkDB All DBs
Position
4141254..4142783
Genome map
AA seq 509 aa AA seqDB search
MVLEANIKAQLNQYMQMIENDIVLKVSAGDDSVSKDMLALVEELASMSSKITVEKAQLDR
TPSFSVNRAEEDTGVTFAGVPLGHEFTSLVLALLQVSGRPPKVDQKIIDQIKNISGEYRF
ESYISLTCHNCPDVVQALNMMSVLNPNISHTMIDGAAYKSEVESKNIMAVPTVYLNGESF
GSGRMTLEEILAKMGSGTDASELSDKEPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVLDTMSIENFISVKRTEGPKLAASLEEHVKDYDIDVMNLQRAKGLEKKDLFHLELE
NGAVLKSKTVILSTGARWRNIGVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADKVLQKRLYSLPNVTVVKNAQTKEITGDENVNGITY
VDRETGEEKHVELQGVFVQIGLVPNTEWLPETVERNRIGEIAVDKRGETTIPGLFAAGDC
TDSPYNQIIISMGSGANAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgaagcaaatatcaaagcacaattaaaccaatacatgcagatgattgaaaat
gacatcgtccttaaagtcagtgcaggcgatgacagtgtctctaaggatatgctggctctt
gtagaagagctggcttccatgtcatcaaaaatcactgttgaaaaggcgcagctcgacaga
acgccaagcttcagcgtcaatcgtgccgaagaagatacaggcgtgacattcgccggggtt
ccgctcggtcacgaattcacatctttggtgctggcactcttgcaagtaagcggcagaccg
ccgaaagtcgatcaaaaaatcatcgatcaaatcaagaacatcagcggcgagtaccgcttc
gaatcttatatcagcctcacatgccacaactgcccggatgttgtgcaggcattgaacatg
atgagcgtgctcaacccgaacatctctcacacaatgatcgacggtgcggcatacaagtca
gaagtcgaaagcaaaaacattatggctgtgccgaccgtatacttgaacggcgaatccttt
ggaagcggccgaatgacgcttgaagaaattcttgcgaagatgggcagcggcacagatgcg
tctgagctttctgataaagaaccgttcgatgtactcgttgtcggaggcgggcctgccggc
gccagcgcagcaatctatgcggcgcgcaaaggcatccgtacgggaatcgttgccgaacgc
ttcggcggccaagtccttgacacgatgagcatcgagaacttcatcagcgtgaagcgcacc
gaagggcctaagcttgcggcaagccttgaagaacacgtgaaggattatgatatcgacgtc
atgaacctgcaacgagcaaaaggcctcgagaaaaaagaccttttccatctagaactcgaa
aacggcgctgttctgaagagcaaaaccgtcattctttcaactggcgcacgctggcgcaat
atcggcgtacccggcgaacaagagttcaaaaacaaaggtgtcgcatactgccctcactgt
gacggaccattgtttgaaggcaaagacgtcgccgtcatcggcggcggcaactccggcatc
gaagcggcgattgaccttgcaggcatcgtcaaccatgtgactgttcttgagtttgcgccg
gagctgaaagcagacaaagttctgcaaaaacgtctctacagcctccccaacgtgactgtc
gtgaaaaacgcccaaacaaaagaaatcacgggcgatgaaaacgtaaacggcattacttac
gtagaccgtgaaacaggagaagaaaaacacgtcgagctccaaggcgtcttcgtccaaatc
ggtcttgtgccgaacacggaatggctgcctgaaaccgtcgaacgcaaccgcatcggcgaa
atcgcagtcgacaaacgcggcgaaacaaccatccctggattgttcgctgccggcgactgc
acagacagcccgtacaaccaaatcatcatttccatgggatccggagcaaacgctgcttta
ggcgcgtttgactacctgattcggaattaa

DBGET integrated database retrieval system