KEGG   Bacillus lehensis: BleG1_0032Help
Entry
BleG1_0032        CDS       T03204                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ble  Bacillus lehensis
Brite
KEGG Orthology (KO) [BR:ble00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ble03012]
    BleG1_0032
   03029 Mitochondrial biogenesis [BR:ble03029]
    BleG1_0032
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ble04147]
    BleG1_0032
Translation factors [BR:ble03012]
 Eukaryotic Type
  Elongation factors
   BleG1_0032
 Prokaryotic Type
   BleG1_0032
Mitochondrial biogenesis [BR:ble03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BleG1_0032
Exosome [BR:ble04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BleG1_0032
  Exosomal proteins of breast cancer cells
   BleG1_0032
  Exosomal proteins of colorectal cancer cells
   BleG1_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AIC92652
UniProt: A0A060LR66
LinkDB All DBs
Position
32767..33957
Genome map
AA seq 396 aa AA seqDB search
MAKEKFDRSKTHANIGTIGHVDHGKTTLTAAITTVLAKRSGKGQAMAYDAIDGAPEERER
GITISTAHVEYETDSRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREH
ILLSRQVGVPYLVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIQGSALKAL
QGEAEWEEKIVELMNAVDEYIPTPERDKDKPFMMPVEDVFSITGRGTVATGRVERGQLNV
GDTVEILGIEEEKKSTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDIQRGQVLAKPGT
ITPHTNFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGICQLPEGTEMVMPGDNIE
MTVELIAPIAIEEGTKFSIREGGRTVGAGVVATIQK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaatttgatcgttccaaaacacatgccaatatcggtacaattggacac
gttgaccatggtaaaacaactttaactgctgcaattacaactgtacttgctaaacgttct
ggtaaaggacaagcaatggcatatgatgcaatcgatggtgctccagaagagcgtgagcgt
ggtatcacaatctcaactgcacacgttgagtatgaaactgattctcgccactatgcacac
gttgactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcacaaatg
gacggaggaatcttagtagtatctgctgctgacggtccaatgccacaaactcgtgagcac
atccttctttctcgccaagtaggcgtaccttaccttgttgtattcttaaacaaatgtgac
atggtagatgacgaagagctacttgagctagtagaaatggaagtacgtgaccttctttct
gagtatgacttccctggtgatgacgttccagttatccaaggttctgctcttaaagcactt
caaggtgaagctgagtgggaagaaaaaatcgttgagcttatgaacgctgttgacgaatat
atcccaactccagagcgcgacaaagataagcctttcatgatgccagttgaggacgtattc
tcaatcactggtcgtggaacagttgctactggtcgtgtagagcgtggtcaacttaacgtt
ggtgacactgtagaaattcttggtattgaagaagagaagaaatctacaactgtaactggt
gtagaaatgttccgtaagcttcttgactatgcagaagctggagacaatatcggtgccctt
cttcgtggggtagctcgtgaagatatccaacgtggccaagtacttgctaagcctggtaca
attacaccacacacaaacttcaaagctgaagtttatgttctttcaaaagaagagggtgga
cgtcacactccattcttctctaactatcgtccacaattctatttccgtacaactgacgta
actggtatctgccaattaccagaaggtacagaaatggttatgcctggtgataacattgaa
atgactgttgagcttatcgctccaatcgcgattgaagaaggtactaaattctcaatccgt
gaaggtggccgtacagtaggcgctggcgttgtagctacaatccaaaaataa

DBGET integrated database retrieval system