KEGG   Bacillus lehensis: BleG1_0289Help
Entry
BleG1_0289        CDS       T03204                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ble  Bacillus lehensis
Brite
KEGG Orthology (KO) [BR:ble00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BleG1_0289
Enzymes [BR:ble01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BleG1_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO Thi4 K_oxygenase FAD_binding_3 Glutaredoxin AlaDh_PNT_C NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AIC92897
UniProt: A0A060LRW1
LinkDB All DBs
Position
complement(260235..261764)
Genome map
AA seq 509 aa AA seqDB search
MALAAEIKTQLNQYMALLENDIVIKVHAGDDDVSKEMVELLDELTAMSTKITLEKAALPR
TPSFSVNRVGEDTGVVFAGVPLGHEFTSLVLALLQVSGRPPKVDQAIIDQVKGIEGEHHF
ESYISLSCHNCPDVVQALNMMSVVNPNITHTMIDGAAFKQEVEEKEIMAVPTVFMNGQPF
GSGRMTIEEMIAKMGVTVDADELTSKDPFDVLVVGGGPAGSSAAIYAARKGIRTGIVAER
FGGQVLDTLSIENFISVPSTDGPKLAASLEEHVKTYNVDVMNLQAAKRLQKKDLFEVTLE
NDAVLKAKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAAELKADRVLQDRAHSLPNVTIIPNAQTTEITGDSHVNGISY
KDRETEEIHHVALQGVFVQIGLVPNTEWLDETVERNRMGEIVVDKHGSTNVPGLFAAGDC
TDSAYNQIIISMGSGATASLGAFDYMIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgcagcagagattaaaacacaattaaaccagtacatggcgttactggaaaat
gacattgttattaaagtacatgctggcgacgatgacgtttcaaaagaaatggttgaatta
ctcgacgaactgacagccatgtctacgaaaattacgcttgaaaaagcagctctgccaaga
acgccaagctttagtgtaaatcgtgttggagaggacaccggcgttgtattcgccggtgtt
cctttaggtcatgagtttacatcgcttgttttggcgttgcttcaggtgagtggacgacca
cctaaggtcgaccaagctattattgatcaagtgaaaggcattgaaggcgagcatcatttt
gaatcctatatcagcttatcttgtcataactgtccagacgttgttcaagcgctgaatatg
atgagtgtcgtaaatccgaacatcacccacacgatgattgacggtgccgccttcaagcaa
gaagtggaagaaaaagaaattatggctgttcctactgtgttcatgaacggtcaaccattc
ggtagcggtcgtatgacaatagaagaaatgattgcaaaaatgggtgttaccgttgacgca
gatgagctaacgagcaaagacccatttgatgttctagtagtcggtggcggtccggctggt
tccagcgcagctatttatgcggctcgtaaaggaatacgtactggtatcgtagcagaacgc
tttggtggacaagttcttgatacactaagcattgaaaattttattagtgtaccgtcaaca
gatggtcctaagcttgcggctagtttagaagaacatgtaaaaacgtataatgtagacgtt
atgaatcttcaagcggcaaagcgcttacaaaagaaagacttgtttgaagtgacccttgag
aatgatgctgttcttaaagccaagacagtgatcttgtcaacaggtgctcgttggcgaaat
gtcaatgttcctggtgaacaagaatttaaaaacaagggtgtggcttactgcccacactgc
gatggccctttatttgaaggtaaggacgttgctgttattggtggtggaaactctggaatt
gaagcggccattgatcttgcaggaattgtgaatcacgttacggttcttgagtttgcggct
gaacttaaagctgatcgtgttctccaagatcgtgcccacagcctaccaaacgtcaccatc
attccaaatgctcaaacaacggaaattacaggtgattctcacgtaaatggcatctcttac
aaagatcgcgaaacagaagaaattcatcatgttgccttgcaaggggttttcgttcaaatt
ggtctcgtaccaaacacagaatggttagacgaaaccgttgaacgtaatcgcatgggtgaa
attgtcgttgataagcacggttctaccaatgtacctggactgtttgccgcaggagattgt
acagacagtgcgtacaaccaaattattatttctatgggctcaggtgctaccgcctccctc
ggcgcgtttgactatatgattagaaattaa

DBGET integrated database retrieval system