KEGG   Bacillus lehensis: BleG1_1393Help
Entry
BleG1_1393        CDS       T03204                                 

Definition
(GenBank) homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Organism
ble  Bacillus lehensis
Pathway
ble00260  Glycine, serine and threonine metabolism
ble00270  Cysteine and methionine metabolism
ble00300  Lysine biosynthesis
ble01100  Metabolic pathways
ble01110  Biosynthesis of secondary metabolites
ble01120  Microbial metabolism in diverse environments
ble01130  Biosynthesis of antibiotics
ble01230  Biosynthesis of amino acids
Module
ble_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ble00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BleG1_1393
   00270 Cysteine and methionine metabolism
    BleG1_1393
   00300 Lysine biosynthesis
    BleG1_1393
Enzymes [BR:ble01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     BleG1_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh NAD_binding_3 Semialdhyde_dh F420_oxidored ADH_zinc_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AIC93976
UniProt: A0A060LRU4
LinkDB All DBs
Position
1363624..1364838
Genome map
AA seq 404 aa AA seqDB search
MKIGLIGYGTVGSGVYERLIGSREQIESIIGEKFEIVRILVKNVEKYKDVNSSLFTSSWD
TFFNTDKYDIVFEAINGTELTRTYTKALLKQGTSVISANKKLVALHGEELEQLAFENQAY
YGWDAAVCGAIPIVNVFKSVLLTTNVQSIAGILNGTSNYILTKMSEGSTYEAALEEAQKL
GYAEEDPTSDVEGWDAVYKLCLLARQCYDQWVCPDDIDRVGISHIDQWHIQAAKELNLSF
KLIAKLESDATSLKGFVKPALIDQEHSLAPIRGVLNAVTLEGKDMERLIFAGPGAGKETT
ANSVVEDFVFHEQQKHVIPRFTNRLTKLEEGIADNVTTQEVWFCKENHESKIQPYLDKTT
VWREHEVKGGKVFVVTPLPFATPFHTFPLLTEMEQLKETVQNES
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagataggtttaatagggtatggaacagttggaagtggtgtatatgaaaggttaatt
ggctcaagagagcaaatagaatccattatcggagaaaaattcgaaatcgttcgcattcta
gttaaaaatgtagagaagtataaggatgttaactcatcattatttacttcatcatgggat
acattttttaatacagataaatacgacattgtgtttgaagcaattaatggaacagaactg
acaagaacatatacaaaggcacttctcaaacaaggcacatctgttatatctgcaaataaa
aagctagtcgcattacacggtgaagaattagaacaactggcttttgaaaatcaagcttat
tatggatgggatgcggctgtatgtggggccatacctattgtgaatgttttcaaaagtgtg
ttattaacaacgaatgtacaatcaattgccggaattctgaacgggacaagtaactatatc
ttaacgaaaatgagcgagggtagcacatatgaagctgcacttgaagaggcgcaaaaacta
gggtatgcagaagaagatcctacatctgatgttgagggttgggatgctgtatataagctt
tgtttgttagctcgacaatgctatgatcagtgggtttgtccagatgatattgaccgagtt
ggaataagtcatattgatcaatggcatattcaagcggctaaagaattgaatttatcgttt
aaattgattgctaaattagaatcggatgcaacgtctttaaaagggtttgttaaaccggct
ttaatcgatcaagaacattcgttagcgcccattcgtggtgtgttaaatgcagtaacactt
gaaggtaaggatatggagcgtcttatctttgcgggaccaggagcaggaaaagaaacaaca
gcaaatagtgtagttgaagattttgttttccacgaacagcagaaacatgtcatacctaga
tttacaaatcgcttaacgaagcttgaagagggaattgctgacaatgtaacgacacaggaa
gtgtggttttgtaaggaaaatcatgaaagtaaaatccaaccgtatttagacaaaacgacg
gtatggagagagcatgaagtaaaaggagggaaagtctttgtcgtgaccccgctccctttt
gctacgccatttcatacatttccgctcttaacagaaatggaacagttaaaagaaactgtt
caaaatgaatcataa

DBGET integrated database retrieval system